KEGG   Natrinema sp. J7-2: NJ7G_2180Help
Entry
NJ7G_2180         CDS       T02184                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00260  Glycine, serine and threonine metabolism
nat00750  Vitamin B6 metabolism
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01230  Biosynthesis of amino acids
Module
nat_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NJ7G_2180
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NJ7G_2180
Enzymes [BR:nat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NJ7G_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AFO57418
UniProt: I7CTG5
Position
1894203..1895378
Genome map
AA seq 391 aa AA seqDB search
MSVSTEMAADLTCPDCGTVYEAGPDEPWRCGCGRALEFTERPHPQGDPLPLHSLDTSEGL
WTFFEFLPIEQHVTFYEGFTPTVEASDWDARFKLEYVFPTGSFKDRGATTTLSRAVELGV
EKVLEDSSGNAGASIATYAARAGVDADIYVPADVKQSKLMTIQRADARPVRIDGTRADVT
TACLEAVEGDANDGDSTGNEGSAPYQTGEGWYASHAWNPAFYAGTMTFAFEVAAQQGWTV
PDAVVLPLGHGTLFLGAYRGFSLLNEAGIVDGMPRLLGAQAAGYAPIVAALGGDTTDAEG
ERTDIADGIQITEPARGTEIVDAIEATDGDAIALGGDAIETALDRLHRNGFYVEPTCAIA
PAALEQYRDDGVIDADDDVVVPLTGSGLKTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgagtactgagatggccgccgatctaacctgtcccgactgcgggaccgtctac
gaggccggaccggacgaaccgtggcgctgtggctgtggccgcgccctggagtttaccgag
cggccgcatccgcagggcgatccgctgccgctgcacagcctcgataccagcgaggggctg
tggacgttcttcgagttcctcccgatcgaacagcacgtcaccttctacgagggctttacg
ccgacggtcgaggcctccgactgggacgcgcggttcaaactcgagtacgtcttcccgacg
ggctcgttcaaggaccgcggcgcgacgacgaccctctcacgggcggttgaactcggcgtc
gagaaggtgctcgaggattcctccggcaacgcgggcgcgtcgatcgcgacctacgcggcc
cgcgcgggcgtcgacgcggacatctacgtcccggcggacgtcaaacagtccaagctgatg
acgatccagcgggccgacgcccgcccggttcgcatcgacggaaccagagcggacgtgacc
acagcctgtctcgaggccgtcgaaggcgacgcgaacgacggcgattcgacgggcaatgag
ggcagcgccccgtatcagaccggcgagggctggtacgccagccacgcctggaaccccgcg
ttctacgccgggacgatgacgttcgcgttcgaggtggccgcccagcaggggtggacggtc
cccgacgccgtcgtcctcccgctcggccacggcacgctcttcctcggcgcgtatcggggc
ttttccctcctcaacgaggccggcatcgtcgacggcatgccgcgcctgctcggcgcacag
gcggccggttacgcgccgatcgtcgccgcgctcggcggcgataccaccgacgcggagggc
gaacggacggacatcgccgacggcatccagatcaccgaacccgcccgcggcaccgagatc
gtcgacgcgatcgaggcgaccgacggcgacgcgatcgccctcggcggggatgcgatcgaa
accgcgctggaccgactccaccgcaacggcttttacgtcgagccgacctgcgcgatcgcg
ccggcggccctcgagcagtaccgcgatgacggcgtcatcgacgccgacgacgatgtcgtc
gtgccgttgaccggcagcggactgaaaaccctctga

DBGET integrated database retrieval system