KEGG   Natrinema sp. J7-2: NJ7G_3289Help
Entry
NJ7G_3289         CDS       T02184                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K19281  beta-methylmalyl-CoA/(S)-malyl-CoA lyase [EC:4.1.3.24]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00630  Glyoxylate and dicarboxylate metabolism
nat00660  C5-Branched dibasic acid metabolism
nat01100  Metabolic pathways
nat01120  Microbial metabolism in diverse environments
nat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NJ7G_3289
   00660 C5-Branched dibasic acid metabolism
    NJ7G_3289
Enzymes [BR:nat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     NJ7G_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFO58508
UniProt: I7CWE5
Position
complement(2833647..2834690)
Genome map
AA seq 347 aa AA seqDB search
MTDDIRLCRTFQTAPAAVPKDDSAKYLTSALEAEGFQAPDWLVPDMEDGTAPDMKAEGLE
NTIETVPEYDFPGEIWPRVEWSYEDAEYREKGRDQIDRLVAEIGDEIDGVVVPKVGRLED
VKRAAEVVAEAEAEHGYDDGSIGLSVIVETGRARSDLRDISKFGADSRLTALVFGPVDYA
AELGGRDLGDGMPRWDGLLEALSNEASAGGLLSIGGPFDDLFKERAGLTYYNADEYADQI
EHEAQLGLDGSWSLYPKQTIQANTVHMPTPDELERDVHKIERFNEAKREGTGAVTIDGQM
VDEATFKNFRNTVQQVRAIDDMRPAQTEEYYDAALLDRARDLELSYR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacattcgactctgccgtacgttccagactgcaccggccgccgttccaaaa
gacgactcggcgaagtacctcacctccgcgctcgaggcggaggggttccaggcccccgac
tggctcgtccccgacatggaggacggaacggcacccgatatgaaagccgagggactcgag
aacaccatcgagacggttcccgagtacgacttccccggcgagatctggccccgcgtcgag
tggagctacgaggacgcggagtaccgcgagaagggccgcgaccagatcgaccgcctcgtc
gccgagatcggcgacgagatcgacggcgtcgtcgtccccaaggtcggccgtctcgaggac
gtgaaacgcgctgccgaggtcgtcgccgaggcggaggccgaacacggctacgacgacggc
tcgatcggcctctcggtcatcgtcgaaaccggtcgtgcccgctccgatctgcgcgacatc
tccaaattcggcgcggactcccggctcaccgcgctcgtcttcggccccgtcgactacgcc
gccgaactcggcggccgcgacctcggcgacggcatgccccggtgggacggcctgctcgag
gccctctcgaacgaggccagcgccggcggcctgctctcgatcggcggccccttcgacgac
ctgttcaaggaacgtgccgggctgacctactacaacgccgacgagtacgccgatcagatc
gaacacgaggcccagctcgggctcgacggctcctggtcgctgtaccccaagcaaacgatc
caggccaacaccgtccacatgcccacgcccgacgaactcgagcgcgacgtgcacaagatc
gaacgcttcaacgaagccaaacgcgaggggaccggcgcggtcaccatcgacggccagatg
gtcgacgaggctacgttcaagaacttccgtaacaccgtccagcaggtccgcgcgatcgac
gacatgcgacccgcacagaccgaagaatactacgacgcggcgctactcgaccgagcgcgc
gacctcgagctgtcgtatcgctga

DBGET integrated database retrieval system