KEGG   Natrinema sp. J7-2: NJ7G_3794Help
Entry
NJ7G_3794         CDS       T02184                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00010  Glycolysis / Gluconeogenesis
nat00620  Pyruvate metabolism
nat00640  Propanoate metabolism
nat00680  Methane metabolism
nat00720  Carbon fixation pathways in prokaryotes
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01130  Biosynthesis of antibiotics
nat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_3794
   00620 Pyruvate metabolism
    NJ7G_3794
   00640 Propanoate metabolism
    NJ7G_3794
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_3794
   00680 Methane metabolism
    NJ7G_3794
Enzymes [BR:nat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NJ7G_3794
Lipid biosynthesis proteins [BR:nat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NJ7G_3794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO59011
UniProt: I7D1H4
Position
3292539..3294614
Genome map
AA seq 691 aa AA seqDB search
MPGNTSPSLADIDEIAHEPSQEFVESTNVWQFMQEYGIDDYEELIERTTTDLEDEPDSGV
DWFWDELVDYLGIEFYEAYDEVRDDSAGPQFTEWYLGGELNIAHNVVDRHAAVDEERRNT
VATIWEGEHGDVREITYHELHRQSNRVANALEERGVGTGDTVGLYMPMVPEVVSILYGCF
KVGAIAVPIFSGFGVDATATRIADAEPTVLFTGDGFYRRGDPVFLKSAADEAIATAGHVE
HTIVFDRLGSSSGARSAAEGRAGHGGSRERTNEHEIPWTDDRDEWWADAVGAADDEYETK
SLASDQESMLLYSSGTTGKPKGIVHTHAGVQVQCPKEVHFGMDLKPADRFFWVSDIGWMM
GPWSLIGTHTFGGTVFMYEGAPDYPEPDRFWEMIDRHRITQFGISPTAIRALRKHGDDWL
SGHDLSSLRILGSTGEPWDPESWHWFHENVGGGEAPIINISGGTEICGCFLMPMPTEPLK
PCTLGGPGLGMDIDVVDREGNSVKENTERGYLVARDSCPSMTKSLWAGDERYLNEYWSTF
EDMWDHGDWAQKDADGFWFLHGRADDALNVAGRKVGPAEVEGVLIDHEAVTQAAAIGAPD
DTTGTAVVTYVVLEDGVDETDDLREDLRTQVGDELGKPFRPREILFVDEFPKTQSGKIIR
RAIQATYTGEDLGDMSSIENPDALEALEDAR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaaatacgagtcccagtctcgctgacatcgacgagatcgcccacgagcccagc
caggagttcgtcgaatcgacgaacgtctggcagttcatgcaggagtacgggatcgacgac
tacgaggaactcatcgaacgaacgacgaccgacctcgaggacgaacccgacagcggcgtg
gactggttctgggacgaactcgtcgactacctcggaatcgagttctatgaggcgtacgac
gaggtcagggacgacagcgcggggccgcagtttaccgagtggtacctcggcggggaactc
aacatcgcccacaacgtcgtggaccgccacgcggccgtcgacgaggagcgccgaaacacg
gtcgccacgatctgggagggtgaacacggcgacgttcgggaaataacgtaccacgaactc
caccgccagtcgaatcgggtcgcgaacgcgctcgaggagcgcggcgtcggcacgggcgac
accgtcggcctctacatgccgatggtcccggaggtcgtctcgatcctctatggctgtttc
aaggtcggcgcgatcgcggtcccgatcttctccgggttcggcgtcgacgcgaccgccact
cggatcgcggacgcggagccgaccgtgctctttaccggcgatggcttctaccgccgcggc
gatccggtcttcctcaagtcagcggccgacgaggccatcgcgacggccggccacgtcgaa
cacacgatcgttttcgaccgactcggctcgagcagcggagcgcgaagcgccgcagagggg
cgggcgggacacggtgggtcccgcgagcggacgaacgaacacgagattccgtggaccgac
gaccgcgacgaatggtgggccgatgccgtcggggcggccgacgacgagtacgagacgaaa
tccctggcctcggaccaggagtcgatgctgctgtactcgtcgggcaccaccggcaagccg
aagggaatcgtccacacccacgcgggggtacaggtccagtgccccaaggaggtccacttc
gggatggacctcaaacccgcggaccggttcttctgggtctccgacatcggctggatgatg
gggccctggagcctgatcgggacgcacacgttcggcggcaccgtcttcatgtacgagggc
gcgccggactaccccgagcccgaccggttctgggaaatgatcgaccgtcacaggatcact
cagttcggcatctcgccaacggcaattcgggcgctgcgaaaacacggggacgactggctc
tccggccacgacctctcttcgctgcgaatcctcggctcaacgggcgagccgtgggacccc
gaatcctggcactggttccacgagaacgtcggcgggggcgaggccccgatcatcaacatc
tccggcggcaccgagatctgtggctgtttcctgatgccgatgccgaccgaaccgctcaag
ccctgtacgctcggcgggcccggcctcgggatggacatcgacgtcgtcgatcgcgagggc
aactcggtcaaagaaaacaccgaacggggctacctggtcgcccgcgactcctgtccctcg
atgaccaagtccctgtgggccggcgacgagcgctacctgaacgagtactggtcgaccttc
gaggacatgtgggatcacggcgactgggcacagaaggacgcggacggcttctggttcctc
cacggccgggccgacgacgcgctcaacgtcgccggccgcaaggtcggccccgccgaggtc
gagggcgtgctcatcgaccacgaggctgtcacccaggccgccgccatcggcgcgcccgac
gacaccaccggtaccgccgtcgtcacctacgtcgtcctcgaggacggggtcgacgaaacg
gacgacctccgcgaggacctgcgcacacaggtcggcgacgagttgggcaaaccgttccgc
ccgcgcgaaatcctgttcgtcgacgagttccccaaaacccagtcgggcaagatcatccgc
cgggccatccaagcgacctacaccggcgaggatctcggcgacatgagcagcatcgagaac
cccgacgcgctcgaggcactcgaggacgcgcggtaa

DBGET integrated database retrieval system