KEGG   Nicotiana attenuata: 109211046Help
Entry
109211046         CDS       T05870                                 

Definition
(RefSeq) pollen receptor-like kinase 3
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109211046
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109211046
Protein kinases [BR:nau01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109211046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_4 LRRNT_2 LRR_8 LRR_6 DUF4381 Orf78 ASFV_J13L V-SNARE_C CD34_antigen TMEM154 Glyco_hydro_59M SARAF EphA2_TM
Motif
Other DBs
NCBI-GeneID: 109211046
NCBI-ProteinID: XP_019230091
UniProt: A0A314KK31
Position
Unknown
AA seq 655 aa AA seqDB search
MANIFHVMIKTCLICIVFLINYPMPSISVTHTEALLKLKQSFTNAESLDSWKPETDPCDK
NSRWIGVICQNQIVRSVLLGRMNLSGNIDVDSLSQLPGLRTLSFRSNSFSGPIPEFNRMG
ALKGLYLSANQFSGEIPSNYFDKMQSLKKLWLSGNKFSGEIPSSILQLHHLIELHLENNQ
FSGPIPTLNQSTLLSLDLSNNNLKGEIPESLSRFNASSFKGNAELCGEKLGKACDHQPPN
SNNNNSTNNKSHGNSNKSISIWVMIASIVLLLIMVVGIYFMCRRQQNRRAAIESFEEPSL
GRRISSDSKKSFELSRRGSSIRKGSINGKRIGDLTMVNDDKGEFGLADLMKAAAEVLGNG
PLGSSYKAMMANGLTVVVKRIKEMNKIGKDGFDAEVRRLGRLRHKNILTLLAYHYRKEEK
LFVYEYIPKGSLMFLLHGDRGIPHAELTWTVRLKIVQGIAQGLSYLHTELASDLPHGDLK
SSNILINTDHEPIVTGYGFYTLINNAHAAQALIAFKSPEAVQNHQVTPKSDIYCLGIVIL
EILTGKFPSQYLNTGKGGIDIVQWVKSAMAEGREAELYDPDIIASAKNSSSQMKELLHIG
AACVESNPQQRINITEVIRRIEEIQQQTGQTIQIMPSLRDGCAEIPVSQSPTRNT
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaatattttccatgttatgatcaaaacatgccttatttgcattgttttcttgatc
aattaccctatgccttcaatttctgttacacatactgaagccttattgaaattgaaacaa
tcatttacaaatgcagaatctttggattcttggaaacccgagaccgatccatgtgacaaa
aatagtcgttggattggtgttatttgtcaaaatcaaattgttaggagtgttctacttgga
cgaatgaatttatctggaaatattgacgttgattcattgtcacaacttcctggtttacga
acacttagttttcgtagtaattcgttctctggaccgatacctgaattcaatcgaatgggt
gcattaaaaggactttatttgtcagcaaatcaattttctggtgaaattccatcgaattat
ttcgataaaatgcagtcattgaagaagttatggctttctggcaataaatttagtggtgaa
attccttcatcaatattacaactgcatcatttgattgagttacatttagagaataaccag
ttttcaggtccaatcccaacgttgaaccagtcgacattgttatcactcgatctttcgaat
aataatttgaaaggggaaattccagagagtttatcaagattcaatgcaagttcttttaag
ggaaatgctgagctttgtggagagaaattaggcaaagcttgtgatcatcagcccccaaat
agcaataataataatagcacgaataataaaagtcatggaaattcgaataaaagcatctca
atttgggtcatgatagcgtccattgtactgttattgatcatggtagtaggaatatatttc
atgtgtcgtaggcaacaaaatcgtcgtgctgctattgaaagttttgaagagccatcactc
gggaggaggatttcgagtgatagcaagaaatcatttgaattaagtcgaagaggcagctcg
atacgcaaaggatcaataaatgggaaacgcataggcgatttgacaatggtaaatgatgat
aagggtgagtttgggttagcagatttaatgaaagctgcagcagaagtgttagggaatggt
ccattgggttcttcttataaagcaatgatggcaaatggattaacagttgttgtaaaaagg
attaaagaaatgaataagattggaaaagatggttttgatgcagaggttaggcgtttagga
agattaagacataaaaatattctaacacttttggcttatcattatcgtaaggaagagaag
ttgtttgtgtatgagtatattcctaaaggcagcttgatgttcctacttcatggtgatcga
ggaattccccatgctgagctcacctggacagtgcgtttaaagattgtacaaggaatagct
caaggattaagttatcttcacactgaacttgcctctgatttgcctcatggcgatctgaaa
tcgagtaatatacttataaacacagaccacgagccaatagtcacaggctacggattctac
accttgatcaacaatgcacacgcagctcaagcactaatcgcgttcaaatctccagaagca
gtacaaaatcaccaagttacacccaaatccgacatttattgcctaggaattgtcattctc
gagatattaacagggaaattcccgtctcaatatctaaataccggtaaaggagggattgat
atagtacaatgggtgaaatccgcgatggctgagggaagagaagctgaattatatgatcca
gatataatagcaagtgccaaaaattcatcgagtcaaatgaaagaattacttcatattggt
gcagcttgtgtagagagtaatccacaacaaaggatcaatattacagaagtaattagaagg
attgaagaaatacaacaacaaacgggacaaacgattcagataatgccatcattgagagat
ggatgtgcggaaataccagtgtcacaatcccctacaaggaacacttaa

DBGET integrated database retrieval system