KEGG   Nicotiana attenuata: 109213359Help
Entry
109213359         CDS       T05870                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nau  Nicotiana attenuata
Pathway
nau03040  Spliceosome
nau04141  Protein processing in endoplasmic reticulum
nau04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nau00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109213359
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109213359
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109213359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nau01009]
    109213359
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nau03041]
    109213359
   03009 Ribosome biogenesis [BR:nau03009]
    109213359
   03110 Chaperones and folding catalysts [BR:nau03110]
    109213359
   04131 Membrane trafficking [BR:nau04131]
    109213359
   03051 Proteasome [BR:nau03051]
    109213359
   03029 Mitochondrial biogenesis [BR:nau03029]
    109213359
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nau04147]
    109213359
Protein phosphatases and associated proteins [BR:nau01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109213359
Spliceosome [BR:nau03041]
 Complex B
  Other components
   Prp19 complex
    109213359
 Complex C
   Prp19-CDC5 complex
    109213359
Ribosome biogenesis [BR:nau03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109213359
Chaperones and folding catalysts [BR:nau03110]
 Heat shock proteins
  HSP70 / DNAK
   109213359
Membrane trafficking [BR:nau04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109213359
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109213359
Proteasome [BR:nau03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109213359
Mitochondrial biogenesis [BR:nau03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109213359
Exosome [BR:nau04147]
 Exosomal proteins
  Proteins found in most exosomes
   109213359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FtsA FGGY_C PilM_2 Hydantoinase_A DUF5398 DP
Motif
Other DBs
NCBI-GeneID: 109213359
NCBI-ProteinID: XP_019232698
UniProt: A0A1J6KEP4
Position
Unknown
AA seq 706 aa AA seqDB search
MASSTAQIHALGATYFTTSSSSRKPSKTVFLGQNLNNRTLAFGLKQKKSSSCRRNGGGHA
PLRVVAEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDRLVGQIAK
RQAVVNPENTFFSVKRFIGRKMNEVDEESKQVSYNVIRDENGNVKLDCPAIGKSFAAEEI
SAQVLRKLVDDASKFLNDKVSKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAA
SLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWL
ASDFKKNEGIDLLKDKQALQRLTETAEKAKMELSSLTQTNISLPFITATADGPKHIETTI
TRGKFEELCSDLLDRLKTPVQNSLRDAKLSFSDIDEVILVGGSTRIPAVQELVKKLTGKD
PNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTKIIPRNTTLPT
SKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDA
NGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDKEKRDAIDTKNQAD
SVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQTMKDAMAALNQEVMQLGQ
SLYNQPGAGAAPGAGPAPGDSAGPSESSSGKGPDGDVIDADFTDSK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcaacagctcaaattcacgctcttggagccacatatttcacaacttcctct
tccagtagaaaaccctcaaagacagtgtttttaggtcaaaacctaaataacagaacccta
gcgttcggactgaagcagaagaagagcagtagctgccggagaaatggtggtggtcacgcg
ccgctgcgggtggtggcggagaaggtggtgggaattgacttgggaacgaccaattccgcc
gtggctgctatggaaggagggaagcccaccatagtgaccaacgctgaagggcagaggaca
acaccttcagtggtggcttatactaagaacggggataggcttgtcgggcaaattgcgaag
cgtcaggctgtggtgaacccggagaatacgttcttttcggtgaagagattcatagggagg
aaaatgaatgaggtggatgaggagtcgaagcaggtctcgtacaatgttattagagatgag
aatggaaacgtcaagctcgattgccctgcaattggcaaatcattcgccgctgaagaaatt
tcagctcaggtcttgaggaagttggtcgatgatgcatccaaatttttgaatgacaaggtt
tctaaggctgttgtcacagttcctgcatacttcaatgattctcagaggacagcaacaaag
gatgccggtcgcattgctggattagaggttctccggataattaatgaaccaactgctgcc
tccctggcttatggttttgaaaagaagaacaatgaaactattttggtttttgatcttgga
ggtggtacttttgatgtatcagttcttgaggttggtgacggtgtctttgaggtgttgtct
acttctggtgatacccatcttggtggtgatgattttgacaagagaattgttgattggctt
gcttcagatttcaagaagaatgaaggtattgatcttctgaaggacaaacaagctcttcaa
cgtctgactgagactgctgaaaaagctaagatggaactgtcatcactcacacagactaac
atcagtttaccattcatcacagccactgcggatggtcctaaacacattgagaccactatc
acacggggtaaatttgaagaactatgctcggatctgcttgacaggcttaaaactcctgtt
cagaattccttgagagatgccaagctctccttcagtgatattgatgaggtgatccttgtt
ggtggttctacacgtattcctgctgttcaggaacttgttaagaaattgactggaaaggac
cccaatgttacagtaaatcctgatgaagttgttgctctcggtgctgcagtgcaggctgga
gtattggccggagatgtcagtgatattgttcttttagatgtcacaccgttgtccattggt
ttggaaacacttggtggtgtgatgacaaagatcattccaagaaatacaacattgcctacc
tcaaaatcagaagtattctctactgctgctgatggtcagacaagtgtagaaattaatgtc
ctccaaggggagcgggaatttgttagggataacaagtctttgggcagcttccggcttgat
ggaattcctcccgccccaagaggggttcctcaaattgaagtgaaatttgatattgatgcc
aatggcattctctccgtcactgctattgacaagggtactgggaagaagcaagacatcacc
attactggtgccagcacattgcccggtgatgaggtcgagagaatggttaaagaagctgaa
agattcgcccaggaagacaaggagaagagagatgccatagacacaaagaaccaggccgat
tctgttgtctaccagacagagaagcagctgaaggaacttggagacaaagtaccggggccg
gttaaagagaaagttgaggctaaacttggagagcttaaagaagcgatctcagggggctcc
actcagaccatgaaggatgcaatggctgcccttaaccaagaagtgatgcagcttggccag
tcactctacaaccagcccggcgctggagctgcaccaggtgctggtccagcacctggcgat
tccgctggtccttcagaatcatcatcagggaaaggacctgatggagacgtaatcgatgct
gatttcaccgatagcaagtga

DBGET integrated database retrieval system