KEGG   Nicotiana attenuata: 109214104Help
Entry
109214104         CDS       T05870                                 

Definition
(RefSeq) pyruvate decarboxylase 2 isoform X1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
nau  Nicotiana attenuata
Pathway
nau00010  Glycolysis / Gluconeogenesis
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109214104
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     109214104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Cys_rich_CWC
Motif
Other DBs
NCBI-GeneID: 109214104
NCBI-ProteinID: XP_019233537
UniProt: A0A1J6L8D2
Position
Unknown
AA seq 614 aa AA seqDB search
MDGSVAKGTSCIQDSQSSSVIGNADATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLI
AEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICI
VGGPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLDDAHEQIDRAISTALK
ESKPVYISISCNLPAIPHPTFSRDPIPFSLSPRLSNKRGLEAAVDAAVTFLSKAVKPVMI
GGPKLRVAKACNAFVELADSSGYAMAVMPSAKGLVAEQHPHFIGTYWGAVGTSYCAEIVE
SADAYLFAGPIFNDYSSVGYSLLIKKEKSIIVQPDRVVIGNGPAFGCVLMKDFLSELSKK
IKKNETAYENYRRIFVPEGTPLKSEPNEPLRVNVLFQHIQKMLSDETAVIAETGDSWFNC
QKLKLPEGCGYVTNNSLSAWYPFYLQTLEEKSSCCRYEFQMQYGSIGWSVGATLGYAQSV
PKKRVISCIGDGSFQVTAQDVSTMIRCEQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNY
TGLVDAIHNGEGNCWTMKVRTEEELTEAIATATGEKKDCLCFIEVIVHKDDTSKELLEWG
SRVCSANGRPPNPQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggacggctcagtagccaaaggcacatcctgtatccaagattctcaatcttcttctgtt
atcgggaacgctgatgccactctcgggcgccatttggcacgtaggctagttgaaattggc
attcaagatgttttctcagtgcctggtgatttcaatctcacacttcttgatcacctcatt
gctgaaccaaggcttaagaatattggctgttgcaatgaactcaatgctggatatgctgct
gatggctatgcacgagctcgcggagttggtgcatgtgttgtcacgtttactgttggtggg
ctcagtgtgcttaatgcaatagctggtgcttatagtgaaaacctacctgttatttgcatt
gtgggaggtcctaatactaatgattatggaactaatagaatactgcatcatactattgga
ttgcctgatttcagccaagaattaagatgttttcagactgttacatgttatcaggccgtt
gtaaacaacttggatgatgcacatgaacaaattgatagagccatttccactgctctaaaa
gaaagcaaaccagtatacatcagtataagttgcaatttgccagccattcctcatccaact
ttcagcagggatcccatcccattttctctttcacctaggttaagtaacaagaggggattg
gaagctgcagtggatgcagcagttacctttctaagcaaggcagtgaaaccagttatgatt
ggagggccaaagctaagagtagccaaagcttgtaatgcttttgttgaattggctgattct
tctggttatgcaatggcagtgatgccatcagcaaaagggctagtcgcggaacaacaccct
cacttcattggcacttactggggtgcagtaggcacatcctattgcgcagaaattgttgaa
tcagctgatgcttacttgtttgctggtccaatctttaacgactacagctctgttggatat
tcacttctgatcaagaaagagaaatcgatcatcgtgcagcctgatagagttgtaattggc
aatggaccagcttttggttgtgtcctaatgaaagatttcctgtctgaactatcaaagaaa
ataaagaaaaatgaaactgcttatgaaaactatcgtcggatatttgtgcctgaaggaaca
cctctaaaatcggagcctaatgaaccactaagagtaaatgttctgttccagcatatacag
aagatgctttcagatgaaacagcagtgattgctgagacaggggattcttggttcaattgc
cagaagcttaagttaccagaaggatgtgggtatgtgactaataacagcttatcagcctgg
tatccattttatttacagacattagaagaaaaaagttcgtgttgcaggtatgaattccag
atgcaatatggctccattggttggtctgttggtgctaccttgggctatgcgcaatctgta
cctaaaaaacgtgtcatatcttgcatcggtgatggaagttttcaggttactgcacaagac
gtgtcaacaatgatccgttgtgagcagaagagcataattttcttgattaataatggtggt
tacaccattgaggttgaaatccatgacgggccatacaatgtgatcaagaactggaactac
actggcttagtggatgctattcacaatggtgaaggcaattgctggaccatgaaggtaagg
actgaagaggagctcacagaagcaattgcaactgcaactggggagaagaaggattgttta
tgcttcattgaagttattgttcacaaggatgatactagcaaagagctgctcgaatggggt
tccagggtgtgttctgccaatggccgtccaccaaaccctcaatga

DBGET integrated database retrieval system