KEGG   Nicotiana attenuata: 109216212Help
Entry
109216212         CDS       T05870                                 

Definition
(RefSeq) histidine kinase 2
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
nau  Nicotiana attenuata
Pathway
nau04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:nau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    109216212
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     109216212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA
Motif
Other DBs
NCBI-GeneID: 109216212
NCBI-ProteinID: XP_019235889
UniProt: A0A1J6KI89
Position
Unknown
AA seq 1262 aa AA seqDB search
MSFSALSGFALKLSRHFLKICRWILLKMSLNCKLLGMNGSFSSSFRLKKAKQGPNCGWSW
QRKLLFLWLIFFGIGFVWLVISLNGVVYSWKQEISQPNEDKSYFLLEHFNVTKQQIQALA
TLFFEKDQISSLKCSKGPGQEMPMSTTITCLLKVLGSENLKYEQQYEMAVENFQAKGQCP
VPDEDALRNSDISLDDKSLPFVLHRLSSLVSADPQLFQKKASQIREVGNHNPDHCNSIAF
CFTKLCWWVLLGIVVSWKMLQLCTKCGENQQHSFIQQQPLSQQLHPLQQLQQQQARISSR
TGGKWRKKLLVIFVSAGVISAIWLYWYMSADIALRRKETLASMCDERARMLQDQFNVSMN
HVHALAILVSTFHHGKQPSAIDQKTFEEYTERTAFERPLTSGVAYALRVRHSEREEFEKL
HGWTIKKMESEDQTLAQDYIPANLDPAPDQDEYAPVIFSQQTVSHIVSIDMMSGKEDREN
ILRARASGKGVLTSPFKLLKSNHLGVVLTFAVYNTHLPPYATPVQRINATVGYIGASYDV
PSLVEKLLHQLASKQTIVVNVYDTTNKFAPIQMYGMDENDTGLLHVSNLDFGDPARKHEM
HCRFKQKPSPPWTAIAASVGVLVITLLVGHIFHAAINRIVEVEGQYQEMMELKHRAEAAD
IAKSQFLATVSHEIRTPMNGVLGMLQMLMDTNLDPTQLDYAQTAHASGKDLISLINEVLD
QAKIESGRLELEAVPFDLRAVLDNVSSLFSGRSHKKGIELAVYVSDLVPEVVIGDPGRFR
QIITNLVGNSIKFTNDKGHIFVTVHLADEVSNPHDVTDEVLKQSLTIVQEKSNASWNTLS
GFPVVDRWQSWQKFDRLRSTEEEVGKIKLLVTVEDTGVGIPVKAQGLIFTPFMQADSSTS
RTYGGTGIGLSISKRLVDLMGGEIGFFSEPGTGSTFSFTVAFARGEEGSLERKRQQYDPA
VSEFRGLRALVIDDKSIRAEVTRYHLQRLGICVNITSTMRSACSYLSSYSNTSALGHLAV
VFVDNDCWDKETSLTLCNMLKELRPNGSTTALGKHPKICLLCMSTMERDELKSAGIVDYV
LAKPLRLSGLITCFQEAIGYQNKKQVTRGKPSTLGSLLTGKHILVVDDNAVNRRVAEGAL
KKYGAIVTCVDSGKAALAHLNPPHKFDACFMDLQMPEMDGFEATRRIRSLENKYNEKVDS
GELLPSMSAKVAHWHTPILAMTADVIQATNEECMKCGMDDYVSKPFEEGQLYSAVARFFE
SG
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttctgctttaagtggctttgctcttaagctgtcaaggcattttctgaagata
tgtaggtggattttattaaagatgtcactgaattgcaaattattgggaatgaatggaagc
ttctcttcaagttttaggctgaagaaagccaaacaaggaccaaattgtgggtggagttgg
caaagaaagcttttgtttttgtggctcattttctttggtattggatttgtttggttggtt
attagcttaaatggtgtggtttatagttggaagcaggagatttcacaaccaaatgaagat
aaatcttattttcttctagaacatttcaatgtcaccaagcagcaaattcaagctttagct
accttattctttgaaaaagatcagatttcatccttgaaatgctcaaaaggtcctgggcag
gaaatgcctatgagtactaccattacttgccttctcaaggtgctaggttcagagaatctg
aagtacgagcagcaatatgagatggccgtagagaactttcaagcaaaaggccagtgccca
gttccagatgaggatgcactgagaaatagtgacatttcactagatgacaagtcgttgcca
tttgttttgcatcgtttatcttcactagtctcagcagaccctcagttatttcaaaagaaa
gcatcacaaataagagaagttgggaatcataacccagatcattgtaatagtattgccttc
tgcttcacaaaactatgctggtgggtccttctcgggattgtggtcagctggaagatgctt
cagttgtgtacaaaatgtggggaaaatcaacagcacagcttcattcagcagcaaccactg
tctcaacaacttcatccgctacagcagttgcagcagcagcaagctcggatttcctctcga
actggtgggaagtggaggaaaaagcttcttgttatctttgtctctgctggggtgatcagt
gccatctggttgtattggtacatgagtgcagacattgcattgagaaggaaagaaacactg
gcaagcatgtgtgacgaacgagcgcgaatgttgcaggaccagttcaacgtaagcatgaac
catgttcatgcattggctattcttgtttccacatttcaccacggaaagcaaccttctgcg
atagaccagaaaacttttgaagaatataccgagagaacagcttttgagaggccacttaca
agtggtgttgcctatgctttaagggttcgtcactcagagagagaagagtttgagaagctg
catgggtggacaatcaagaaaatggaatccgaggaccaaactttagcgcaagattatatc
cctgcaaacttggatcctgctcctgatcaagatgaatatgcacctgtcatattttcacaa
caaactgtttcccatatcgtctcgattgatatgatgtcaggaaaggaagaccgtgagaac
attttgcgagcgagggcttctggcaagggggttttgacgtcaccctttaagctattgaaa
tccaatcaccttggtgttgttcttacatttgcggtctataatactcatctccctccttat
gctaccccagtgcaacgcatcaatgctactgttgggtacattggtgcttcctacgatgtt
ccatcattagtagaaaagcttctgcatcagcttgcaagcaagcaaactattgtggtaaat
gtttatgatacaactaacaagtttgctccaattcaaatgtacggcatggatgagaatgac
acgggattactgcatgttagcaaccttgattttggggatccagcaaggaagcacgagatg
cattgcaggttcaagcagaaaccttctccgccctggacagcaatagctgcatctgttggc
gtcctcgttatcactctgcttgttggtcacatcttccatgctgccatcaaccgaatcgtc
gaagttgagggtcagtatcaagaaatgatggaactcaaacatcgtgctgaggctgccgat
atagcaaaatctcagtttcttgcaacggtttctcatgaaatcaggactccgatgaatggt
gttttaggcatgcttcaaatgctcatggacacaaaccttgaccctacgcaactggattat
gcacaaaccgctcatgctagtgggaaagatctgatatcgttgattaatgaggttcttgat
caggctaagattgaatcaggaaggcttgagctggaggccgttccttttgatctccgtgct
gtacttgataatgtttcatcactcttctcaggaagatctcataaaaaagggattgagttg
gctgtttatgtttctgatctagtcccagaagttgttatcggagatccaggacggttccgg
cagataattacaaatctagttggaaactcaattaagttcacaaatgacaaagggcacata
tttgtcacggtacatttagctgatgaagtgagcaaccctcatgatgtgacggatgaagtc
ttgaaacaaagcttaaccattgttcaagaaaagtcaaatgcatcttggaataccttaagt
gggtttcctgtagttgacagatggcaaagttggcaaaagtttgataggctgcgcagcaca
gaggaagaagtgggaaagatcaagttgttagtgaccgtagaagatactggcgtgggaatt
cctgttaaagcacaaggccttattttcacaccttttatgcaggctgacagttcaacatct
cgaacatatggtggaacaggtataggattgagcattagcaagcgtttggtggacctcatg
gggggagaaatcgggtttttcagtgaacctggcacagggagtacattttcattcactgtt
gcctttgcaagaggagaagaaggttcattagagcgtaaacggcaacagtacgatccagct
gtttcagagtttcgtggtttaagagcattggtaattgatgataaaagcattcgggcagag
gtcacaagataccatctgcagagactgggaatatgcgtcaacataacttcaacgatgcgt
tcggcatgctcatatctctctagttactctaatactagtgcattgggacatttagctgtg
gtttttgttgacaatgattgttgggataaggaaacttctcttacactttgtaatatgttg
aaagagctcagaccaaatggctcaactactgctttgggaaagcatccaaaaatctgtctg
ttatgtatgagcactatggagagagatgagctcaaatcagctggtattgtggattacgtg
ttagcaaagcctctgcgattgagtgggttgataacatgctttcaagaagccattggctac
caaaacaagaagcaagtaacccgaggaaaaccttcaactcttggaagtctgctgacgggc
aagcatatattggtggtagacgataatgctgtaaacagaagagtggcagaaggtgctcta
aagaagtacggggcgatagtgacctgtgtagacagtggaaaggctgctctagcacatctt
aatccaccacacaagtttgatgcttgttttatggacctccaaatgcctgaaatggatggg
tttgaagcgacaagacgaatacgcagtctagaaaacaaatacaacgaaaaagtcgattct
ggtgagttacttcccagcatgtctgccaaagtggctcattggcacaccccaatattagca
atgacagcagatgtaattcaagcaacaaatgaagagtgcatgaagtgcgggatggatgat
tatgtatcaaaaccgtttgaagaaggacaactttattcagcagtggcacgcttctttgag
tcaggttga

DBGET integrated database retrieval system