KEGG   Nicotiana attenuata: 109218458Help
Entry
109218458         CDS       T05870                                 

Definition
(RefSeq) serine/threonine-protein kinase At5g01020-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109218458
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109218458
Protein kinases [BR:nau01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109218458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109218458
NCBI-ProteinID: XP_019238373
UniProt: A0A1J6JZ96
Position
Unknown
AA seq 439 aa AA seqDB search
MVLTWKSMIPCCYKVDDELIRSKKKVKKQSSFQRLTLLDFDDPSSPLSADGLSNSFIGSN
LINFTFTQLREVTHHFSSANFLGEGGFGPVYKGFVDDKLRPGLKPQVVAVKVLDTDGLQG
HKEWLTEIIFLGQLRHPHLVKLIGYCWEDNNRLLVYEFLPRGSLENQLFGKFSITLSWST
RMKIALGAAKGLAFLHEGEKPVIYRDFKASNILINSDYTAKLSDFGLAKDGPAGDDTHVS
TRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLEMLTGKRSLDKKRREGETNLVEWLRP
YLRDPKKIARVMDRRLEGEYPIKDAQTAALVAYKCLSHYPKPRPTMDDVVKILETLQEES
NNTNTAISDPMITMTSNSDFSSESEKNGEKEDAATPERNGRSRKEKYLNGKNQGYGWRQR
INRQRMVASYSDTALYRRH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggttttaacttggaaatcaatgattccatgttgttacaaagtagatgatgagttaata
agatcaaagaaaaaggtcaaaaaacaaagttcatttcagagattgactctattagatttt
gatgatccaagttcaccattatctgctgatggattatccaattcattcattggatcaaac
cttatcaacttcacatttactcaacttagagaggttacacaccatttttcatctgctaat
tttcttggtgaaggaggatttggacctgtatacaagggattcgtcgacgataagcttagg
ccagggttaaaacctcaggttgtagctgttaaggtgttggatacagatggtttgcaaggt
cacaaggaatggctgacagagataatattcttggggcaactgaggcatccacatctggta
aaattgattggatactgctgggaagataataatagactcctagtctatgaattcttgcca
aggggaagcttggaaaatcaactctttggaaagttttcgatcacattatcgtggtcaaca
aggatgaagatagcattaggagcagcaaaaggtctcgcgttcctccatgaaggcgaaaaa
ccagtcatatacagagattttaaggcatcaaacatcttaataaattcagattacactgct
aaactttctgatttcggactagcaaaggatggaccagcaggggacgatacgcatgtatcc
acacgaataatgggtacacacggctacgcagcccctgaatacatcatgacaggtcatttg
acaacaatgagtgatgtatacagctttggagtagttctgttggaaatgctgactggtaaa
agatctttggataaaaaaagacgagaaggagaaacgaatttggttgaatggttaaggcct
tatttaagagatccaaagaaaattgctcgtgtgatggaccgaagacttgaaggtgaatac
ccgattaaagacgcacaaactgcagcattagtagcatacaaatgcttaagtcattatcct
aagcctagacctacaatggatgatgttgtcaagattcttgagacacttcaggaggaaagc
aacaacactaacactgcaataagcgatccaatgataacaatgacatcgaacagtgatttc
agcagtgagagtgagaaaaatggcgaaaaagaggatgctgcaacacccgaacgaaatggg
agaagcagaaaggagaagtacttgaatgggaaaaatcaaggttatggatggagacagaga
atcaataggcagagaatggtggcgtcttactcggatacagctctttatagaaggcattga

DBGET integrated database retrieval system