KEGG   Nicotiana attenuata: 109220891Help
Entry
109220891         CDS       T05870                                 

Definition
(RefSeq) inactive receptor-like serine/threonine-protein kinase At2g40270
Organism
nau  Nicotiana attenuata
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRRNT_2 LRR_8 LRR_4 LRR_1
Motif
Other DBs
NCBI-GeneID: 109220891
NCBI-ProteinID: XP_019240906
UniProt: A0A1J6K493
Position
Unknown
AA seq 647 aa AA seqDB search
MNERWKFSKHGLLVFAVFLCFVYQKLSFCWSLNDEGLALLRFRERVENDPFGALSNWKDD
EMENPCSWFGVGCFNGNVVALDLKDLHLCGTLAPDLVRLVHLRIIILRNNSFSGVIPDEI
AKLKKLEILDLGYNNFSQPLPSDFCNNPSLLLDSNELFSHVFSGTDRLQMVPDVQANNNH
FPGAQPMSPTNGKLILRSTTELGDVAGRKLLQVSSFPPLNNFWKQFQPVLAPPEVGVKNN
APSSSPSPAPSPSLSPSPTPSITAKPHLAPSPTSSSSSSPSSLPSPAENPSGLENSRRSH
HRVIILSAAIGGPILLLILITGAIFFRSNKIAVVKPWATGLSGQLQRAFVTGVPKLKRSE
LEAACEDFSNVIGSSSVCTLYKGTLSSGVEIAVISRTVESAKDWSKDMEAQFRKKIDTMS
KVNHKNFVSLLGYCEEEEPFTRMMVFEYAPNGTLFEHLHIREAEHLDWGMRMRIAMGMTY
CLEHMHNLSPSLPHKNLTSSAVYLTEDYAAKISDFGFWNETAAAETGLSPESNVYSFGVI
LFEMMTGRLPYSANSGSLDDWAADYLREGQTLREMVDPTLNSFQEEQLERIADVIRMCVH
PEPRQRPTMREVSGRLREITGIGPDGAIPRLSPLWWAELEIISTEAC
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcgctggaaattcagtaagcatggtttgttggtttttgctgtgttcttgtgt
tttgtgtatcagaaattgagtttctgttggtccctcaacgatgaaggtttggcactgctg
agatttagagagagagtggagaatgacccatttggggctttgtcgaattggaaagacgat
gaaatggaaaatccgtgttcttggtttggagttgggtgctttaatggaaatgttgtggct
ctggacttgaaagatcttcatctctgtggtactctagctcctgatctcgtgcgcttggtt
cacttgaggattataattttacgtaacaactccttttctggggtcatacccgatgagatt
gcaaagctaaaaaagttggagattctggaccttggatataataactttagtcagccgctg
ccttctgacttttgcaataatccctctcttttattagacagcaatgagctgtttagccac
gtattttctggaactgataggcttcaaatggtcccagatgttcaagcaaataacaaccac
tttcccggagcccaacctatgtcacctaccaatgggaaattgatattaaggagtacaaca
gaacttggagatgtagctggaagaaaattactacaagtgtcatcttttcctcccctgaat
aacttctggaagcaatttcagccggttttagctcctcctgaagttggtgtcaagaacaat
gcgccttcatcctccccatctccagctccaagtccttctctttccccatctcctacaccg
tcaattactgctaaacctcacctggctccttcaccaacatcctcctcttcttcttctcca
tcttcacttcccagtcctgcagagaacccaagtggacttgaaaattccagacgaagtcat
catcgagttataatattgtctgcagctataggaggtcccattctactgctcatattgata
actggcgcaatcttctttcgaagcaacaaaatagctgttgtaaaaccttgggccactggt
ttgagtggtcagttgcagagagcatttgttactggcgtgccaaagctgaagagatcagag
cttgaagcagcctgtgaagatttcagcaatgtaatcggttcctcatctgtttgcacacta
tataaaggcacattatctagtggagttgagatagctgtgatctctcgtacagtggaatct
gctaaggattggtctaaagatatggaagcccaattcaggaaaaagattgatacaatgtca
aaagtcaatcacaagaactttgtcagcctcctcggttattgcgaagaagaggagccattt
accagaatgatggtttttgagtatgctcctaatgggacgctctttgaacatctgcatata
agggaagctgaacacttggactggggaatgcgaatgaggatagcaatgggcatgacatac
tgccttgagcatatgcacaatttatcgccatctttaccccataaaaacttgacttcctcc
gccgtgtacctcacagaggactatgcagccaaaatatcggattttgggttctggaacgag
acagctgcagctgaaacggggttgagtccagaaagtaatgtttacagctttggtgtcatt
ttatttgagatgatgaccggtaggctgccttactcggcaaacagcggctctcttgatgac
tgggcagcagactatctaagggaaggacaaaccctgagggaaatggtggatccaacttta
aattctttccaagaggagcagctagagagaatagctgatgtgattagaatgtgtgtacat
cctgagccaagacaacgaccgacgatgagagaggtttcgggcagattgagagagataaca
ggtataggaccagatggggcaatcccaagactctctcctctatggtgggctgagcttgag
attatatcaacagaggcttgttaa

DBGET integrated database retrieval system