KEGG   Nicotiana attenuata: 109221356Help
Entry
109221356         CDS       T05870                                 

Definition
(RefSeq) probable phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
nau  Nicotiana attenuata
Pathway
nau00770  Pantothenate and CoA biosynthesis
nau01100  Metabolic pathways
Module
nau_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    109221356
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     109221356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 109221356
NCBI-ProteinID: XP_019241379
UniProt: A0A1J6JNY3
Position
Unknown
AA seq 213 aa AA seqDB search
MEPMTSEREPVQINNAPRRPRILLAASGSVAAIKFASLCRSFTEWAEVKAVATKASLHFI
DKASLPEDVILYTDEDEWSTWTKIGDSVLHIELRRWADIMIIAPLSANTLGKIAGGLCDN
LLTCIVRAWDYDKPLFVAPAMNTLMWNNPFTEKHLMVIDELGISLIPPVSKRLACGDYGN
GAMAEPSLIYQAVRIYYDAQLRSGGSNVAIHRS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggagcctatgacttcagagagggaaccggttcagattaacaatgcaccgaggagacct
cgtattctgcttgcagcaagtggaagtgtggctgctatcaagtttgccagtctatgccgt
tcctttactgagtgggctgaagttaaagcggttgctacaaaagcttctcttcatttcata
gacaaagcttcacttccagaagatgtcattctttatactgatgaggatgaatggtcaact
tggacgaagataggtgacagtgtgctacacatcgagctccggaggtgggctgatattatg
attattgcccctttgtcagcaaacacacttgggaagattgctggtggactatgtgataac
ttgttaacctgcatcgtacgagcatgggactacgataaaccccttttcgtggcaccagca
atgaatacattgatgtggaataatccattcacagaaaagcaccttatggtaattgatgag
cttgggatctctctcataccaccagtatcaaagagactagcctgtggagattacgggaat
ggagcaatggctgaaccgtctctgatctaccaagctgtaagaatctattatgacgcacaa
ttacgatcaggtggcagcaacgtggcgatccacaggtcatga

DBGET integrated database retrieval system