KEGG   Nicotiana attenuata: 109223985Help
Entry
109223985         CDS       T05870                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nau  Nicotiana attenuata
Pathway
nau00020  Citrate cycle (TCA cycle)
nau00480  Glutathione metabolism
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
nau01200  Carbon metabolism
nau01210  2-Oxocarboxylic acid metabolism
nau01230  Biosynthesis of amino acids
nau04146  Peroxisome
Module
nau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109223985
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109223985
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109223985
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     109223985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 109223985
NCBI-ProteinID: XP_019244051
UniProt: A0A1J6IKJ3
Position
3
AA seq 415 aa AA seqDB search
MTFDKIKVENPIVEMDGDEMTRVIWKSIKDKLICPFLGLDIKYFDLGLPHRDATDDKVTV
ESAEATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIP
RLVPGWTKPICIGRHAFGDQYRATDTVIQGAGKLKLVFVPEGTDEKTEFEVYNFTGAGGV
ALSMYNTDESIRSFAEASMNMAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSK
YEEAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCP
DGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLEFTEK
LEAACIGAVESGKMTKDLALIIHGSKLSREHYLNTEEFIDAVADELKARLLKAKA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgacaaaatcaaggttgaaaaccctatcgttgagatggacggagatgaaatg
actcgtgttatttggaaatcaatcaaggataagctcatctgtccctttctggggttggat
ataaaatactttgaccttggccttccccaccgtgatgccacagacgataaggttacagtt
gaaagtgcggaagccactcagaaatacaatgtagctattaagtgtgcaaccattactcca
gatgaggcccgtgtaaaagagtttaacttgaaatccatgtggaggagccctaatgggaca
attagaaacatcctaaatggaacggtcttcagagaaccaattatgtgcaaaaatattccc
cgacttgtcccaggttggactaaaccaatatgcattggtagacatgcttttggcgatcaa
taccgggctactgatacagttattcaaggagctggaaaactcaaattggtgtttgtgcca
gaaggaacagacgagaagactgaatttgaagtttacaactttactggtgctggtggagta
gctttatccatgtacaatacagatgagtccatccgctcatttgctgaggcttcaatgaac
atggcataccaaaagaaatggccactctatcttagtacaaagaatactattcttaagaaa
tatgatgggaggtttaaggacatcttccaagaagtttatgaagcaaattggaagtccaag
tatgaggaagcaggaatttggtatgaacaccgtcttatcgacgatatggttgcttatgct
ttaaagagtgaaggtggttatgtatgggcctgcaagaactatgatggggatgtacagagt
gatttcttagcacaaggttttggatcccttgggttgatgacatctgtcctggtgtgtcct
gatggcaagaccattgaggctgaagcagcccatggaactgtcacccgccactacagggtt
caccagaaaggaggtgaaaccagcacaaacagtattgcgtcaatctttgcctggactcgt
ggacttgcacacagggcaacgttagacaacaatgaaaggctcttggagtttactgagaaa
ctagaggcagcatgcattggtgcagtggaatctggaaagatgaccaaagatcttgcactc
atcatccatggatccaagctctcaagagaacattatctcaacactgaggagttcatcgac
gctgtggccgatgagcttaaagcaagacttctgaaagcaaaggcctaa

DBGET integrated database retrieval system