KEGG   Nicotiana attenuata: 109225672Help
Entry
109225672         CDS       T05870                                 

Definition
(RefSeq) nucleoside diphosphate kinase 1-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nau  Nicotiana attenuata
Pathway
nau00230  Purine metabolism
nau00240  Pyrimidine metabolism
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
nau04016  MAPK signaling pathway - plant
Module
nau_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nau_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
nau_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109225672
   00240 Pyrimidine metabolism
    109225672
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    109225672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nau04131]
    109225672
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     109225672
Membrane trafficking [BR:nau04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109225672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 109225672
NCBI-ProteinID: XP_019245965
UniProt: A0A1J6IGX2
Position
5
AA seq 148 aa AA seqDB search
MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNG
LVEYIVSGPVVAMVWAGKSVVTTGRKIIGATNPLESAAGTIRGDYAIDIGRNVIHGSDSV
ESAKKEIALWFPEGVAEWQSSLHSWIYE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaccttcatcatgatcaagcctgatggtgtccaacgtggcctggttggcgag
attattggaagattcgagaaaaaaggtttctctttgaaaggcttgaagctgattactgtg
gatcgcgcttttgctgaaaagcactatgcggacttgtctgcaaagccattcttcaatggt
cttgttgaatacattgtttctggccccgttgttgcgatggtctgggcgggtaagagtgta
gttactaccggtaggaagataattggcgcaacaaatccattggaatctgctgctggcacc
atccgtggtgattatgctattgacattgggaggaacgttatccatggaagtgattctgtt
gagagcgctaagaaggaaattgctctttggtttcctgaaggtgtcgcggagtggcagagc
agccttcactcttggatctatgagtaa

DBGET integrated database retrieval system