KEGG   Nicotiana attenuata: 109228204Help
Entry
109228204         CDS       T05870                                 

Definition
(RefSeq) serine/threonine-protein kinase CDL1-like
Organism
nau  Nicotiana attenuata
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 109228204
NCBI-ProteinID: XP_019248912
UniProt: A0A1J6ISQ8
Position
6
AA seq 405 aa AA seqDB search
MICFSCCLSSEDKIQTRNSLKKSIQDTKSISSFANISIKTDRSRRRYIVEEIEKYGKGNI
SAQTFTFNDLALATKNFDSECLLGEGGFGKVYKGHIDSKNIDVAVKQLDRNGFQGNREFL
VEVLLLSLLHHPNLVTLEGYCSDGDQRILVYEFMSNGSLEDHLLELSPEKRPLDWITRMR
IAEGAARGLEYLHETANPSVIYRDFKASNILLDENFNPKLSDFGLAKLGPTGEKTHVSTR
VMGTYGYCAPEYASTGQLTTKSDVYSFGVVFLEIITGRRVIDSSRPSEEQNLVVWATPLF
RDKKKFHLMADPLLGGDYPMKALYQALAIAAMCLQEEASTRPLMSDVVTALEFLSGNKTD
LEAEGGEEEAAEDDHTFKSPPALQSFTSRLERAESNDTNAIRERD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtttttcatgttgcttgtcatcagaagacaagattcagactagaaattctttg
aaaaaaagcattcaagacaccaaatctatatcgtcattcgccaatatttctattaaaact
gatagaagcagaaggagatacatagttgaagagatagaaaaatacggaaaaggaaacatt
tcagctcagacattcacattcaatgacttggctcttgccactaaaaactttgattctgaa
tgtttgcttggtgaaggtggttttggaaaagtatacaagggccacattgacagcaagaat
atagatgttgctgtaaagcaacttgataggaatggcttccaaggaaatagagagttcctt
gtggaggttctgttgttgagccttcttcatcaccctaaccttgttactttggaaggatat
tgctcagacggcgaccagcgaatattagtctatgaattcatgtcaaatggttcactagaa
gatcaccttcttgagcttagtccagaaaaaaggccacttgattggattacaaggatgaga
attgcggaaggagcagccagaggacttgaatacttgcacgaaacagctaatccttcagta
atttaccgcgattttaaagcatccaatatacttttagacgagaacttcaatcccaagctt
tctgattttggactagccaagttaggtccgactggtgagaagactcatgtttccaccagg
gttatgggaacctatggttattgtgcacctgagtatgcttccacaggtcaattgacaaca
aagtctgatgtttacagctttggagttgtctttttggaaataatcacaggcagaagagtt
attgacagctctaggccgagtgaagaacagaaccttgttgtctgggcaacaccactattc
agagacaagaagaagtttcacttaatggcagatccattgttaggaggggattatccaatg
aaggcactgtaccaagctctagcaattgcagcaatgtgcctgcaagaggaagccagtaca
cggcctctgatgagcgacgtggtaactgctttggagtttttatccggtaacaagacggat
ttagaggcagaggggggagaagaggaggctgcagaagatgatcacacattcaaatcccca
cctgcattgcaaagttttacgagtagacttgaacgcgctgaaagtaatgataccaatgcc
attagggaaagagactag

DBGET integrated database retrieval system