KEGG   Nicotiana attenuata: 109228860Help
Entry
109228860         CDS       T05870                                 

Definition
(RefSeq) mitogen-activated protein kinase 19
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nau  Nicotiana attenuata
Pathway
nau04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:nau00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109228860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109228860
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nau03036]
    109228860
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nau04147]
    109228860
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109228860
Protein kinases [BR:nau01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109228860
Chromosome and associated proteins [BR:nau03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109228860
Exosome [BR:nau04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109228860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 109228860
NCBI-ProteinID: XP_019249644
UniProt: A0A1J6INA0
Position
7
AA seq 603 aa AA seqDB search
MQQDYRKKSSKEVEFFTEYGDANRYKILEVIGKGSYGVVCAAIDTHTGEKVAIKKITDIF
EHISDAIRILREVKLLRLLRHPDIVEIKRIMLPPSRREFRDIYVVFELMESDLHHVIKAN
DDLTHEHHRFFLYQMLRALKFMHTANVYHRDLKPKNILANANCKLKICDFGLARVAFSDT
PTSIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQL
DLITDLLGTPSADIVSGVRNEKARKYLTDMRKKSPVPFTEKFPNADPLALGLLRRLLAFD
PKDRPTAEQALADPYFKGLAKIEREPSSPPISKLEFEFERRMVTKEDIRELIFREILEYH
PQLLKDYMAGNDGANFLYPSAIGNFRRQFAFLEENSGKSGPVIPPGRKHVSLPRSTVNSS
TIPPRTQQNPMFDHRQVTEKATAGVRVTDQKVLRPPPRVPTAKPGRAVGPVLRYDGDRSM
KEVADGRVYSQNPVLPPHGISPHYLFRSNSANLEKYGTEAEKDRSQVKPQPGQCMVAKST
SSMSIDMNTNPYYHTQAKVAQLGGQLAIDAKLLQAQTQFGAVGAAAVAVAAHREVCTVQY
GLT
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagattatcgcaagaagagttccaaagaagtggagttcttcaccgagtacggt
gatgcgaataggtataaaattttggaagttataggcaagggaagctatggagtagtttgt
gctgccattgacactcatacaggagagaaagtggctataaagaaaataactgatattttc
gagcacatctctgatgcaattcgaattctgcgtgaagtcaaattgcttagacttcttagg
catcccgatattgttgaaattaagcgaatcatgttaccaccttcaagacgagaatttcga
gatatttatgttgtttttgagcttatggaatctgatcttcaccatgtcattaaggccaac
gatgacttgacacatgagcaccatcggtttttcctctatcagatgctgcgagcattgaag
tttatgcacacagcaaatgtttaccaccgagatcttaagcccaaaaatatattggcaaat
gcgaattgtaaactcaaaatatgtgactttggattggcaagggttgcattcagtgatact
ccaactagtatattttggacggattatgttgctacaaggtggtaccgagcaccagagcta
tgtgggtctttcttctctaagtatacacctgctattgatatctggagtattgggtgtatc
tttgcggaggtcctgacagggaaaccgctgtttccaggcaaaagtgttgtgcaccagttg
gatttgattactgatcttcttgggacaccatcagctgatatcgtatctggggttcgcaat
gagaaggcaaggaagtatttgacagacatgcggaaaaagagcccagttccttttaccgag
aaatttccaaatgcagatcctttggctctcgggctgttgcggaggttgttagcatttgat
ccaaaggatcgcccaactgctgaacaggctttggctgatccttactttaagggactggcc
aagattgagagggaaccttctagtccaccaatctcgaagctggagttcgagtttgagcgg
cgaatggtcaccaaggaggacattagagaactaatatttcgggagatactagagtaccat
cctcagcttctgaaggactacatggctggaaatgatggtgcaaattttctctatcctagt
gccattggtaatttcagaaggcaatttgcctttctcgaggaaaatagtggtaaaagtggt
ccagtaattcctcctggtcgaaagcacgtctctctcccacgatctacggttaattccagt
accatccctcccagaacacaacagaaccctatgtttgatcataggcaagtaacagaaaag
gcaactgctggcgtcagagtcacagaccagaaggttttgcgaccaccacctcgagtaccc
acagccaaacctggaagagcagtagggccggttttacgatatgatggtgacagaagcatg
aaagaagtcgctgatggaagagtatattctcagaatcctgtcctcccaccgcatggcatt
tctccacattatttgttcagaagtaattctgcaaatctagagaagtatggaaccgaagca
gagaaggaccgctctcaagttaagccgcaacctgggcagtgcatggttgccaagtcgacg
tctagtatgagtatcgatatgaacaccaacccgtactaccatacacaggcaaaggtagca
cagttgggaggtcaacttgccatagatgcaaaactactacaggcacaaacacagtttggg
gcagttggggctgcagctgttgctgttgctgctcacagagaggtttgcaccgttcagtat
ggtctaacctag

DBGET integrated database retrieval system