KEGG   Nicotiana attenuata: 109229027Help
Entry
109229027         CDS       T05870                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
nau  Nicotiana attenuata
Pathway
nau00760  Nicotinate and nicotinamide metabolism
nau01100  Metabolic pathways
Module
nau_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109229027
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     109229027
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     109229027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 109229027
NCBI-ProteinID: XP_019249874
UniProt: A0A1J6I7X6
Position
7
AA seq 252 aa AA seqDB search
MTDIALPWDKLSLDLIKQEEGQSSAERKKRTYVVLVSTGSFNPPTYMHLRCFELARDALT
SEGLCVIGGYMSPVNDAYKKKGLISAEHRVAMCQLACKSSEFVMTDPWEATQDSYQRTLT
VLSRIKSALCGGSLASSEALMVMLVCGSDLLESFSTPGVWIPEQVRTICRDFGLVCVRRG
GQDVEKIIAGDDILNEYKKNIKVVDEVVPNGISSTGLRDCISKGLSVKYLTADEVIDYMK
QHNLYRGQCSNN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattgctttaccatgggataagttgtctttagatttaataaaacaagaggag
gggcaatcaagtgctgaaaggaagaaaaggacatatgtagttcttgtatccacaggaagt
ttcaatcctcctacttacatgcacttgcgctgttttgagttggcaagagatgcattgact
tcagaagggctttgcgtaattggaggttatatgtcaccagtaaatgatgcatataagaag
aagggtcttatatctgctgagcatcgtgttgcaatgtgccaattagcttgtaaaagctca
gaattcgttatgacagatccctgggaggcaacccaggatagctatcaacgaacattgaca
gttctctccagaataaagtccgctctctgtggtggaagtttggcatccagtgaagccctc
atggtcatgcttgtgtgtggttctgatctgctagaatctttcagcacacctggagtttgg
atacctgagcaggtcaggaccatatgtagagactttggcttggtttgtgtccggcgaggt
ggtcaggatgttgaaaagatcattgcgggtgatgatattttgaacgaatataagaaaaat
atcaaagttgtggatgaagtagtgcctaatggaatcagttcaacgggattaagggactgc
atctcgaaagggttatcagtgaagtacttgacagccgatgaagtaattgattatatgaaa
caacataacctttatagagggcaatgttctaacaactga

DBGET integrated database retrieval system