KEGG   Nicotiana attenuata: 109229466Help
Entry
109229466         CDS       T05870                                 

Definition
(RefSeq) mannose-1-phosphate guanylyltransferase 1-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
nau  Nicotiana attenuata
Pathway
nau00051  Fructose and mannose metabolism
nau00520  Amino sugar and nucleotide sugar metabolism
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Module
nau_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    109229466
   00520 Amino sugar and nucleotide sugar metabolism
    109229466
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     109229466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Hexapep_2 IspD
Motif
Other DBs
NCBI-GeneID: 109229466
NCBI-ProteinID: XP_019250454
Position
7
AA seq 402 aa AA seqDB search
MVDSHMIEHLTRGGSRIYALWVQPLRQPFVFSDAGSLLVFIMKALILVGGFGTRLRPLTL
NVPKPLVDFANKPMIVHQIEALKAIGVTEVVLAISYQPKTMENFLKEFEKKLDIKITCSE
ETEPLGTAGPLALARHILRDDSDEPFFVLNSDVICDYPLKEMIEFHKSHGGQASIMVTKV
DEPSKYGVVVMEEGTGRVETFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVF
PSIAAEKKLHAMVLPGFWMDIGQPKDYITGLRLYLDSLRKRSSPDLGVGPHILGNVLIDE
SAVIGDGCLIGPDVAIGPGCVIESGVRLSCCTIMRGVRIKKHACISFSIVGWHSTVGRWA
RVENMTILGEDVHVGDEVYSSGGVVLPHKEIKSSILKPEIVM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggttgatagtcacatgattgagcatctaaccagaggcggatctagaatatacgctcta
tgggttcagcctttaaggcaaccttttgttttttctgatgcaggcagccttttggttttc
attatgaaggcactcatcctcgtagggggttttggaacaaggctgaggccgctgaccctc
aacgtgccaaagcccctagttgactttgctaacaagcccatgatagtacatcagattgaa
gcactaaaagccattggagtgactgaagtagttttggcaattagctaccagccgaagaca
atggaaaacttcttgaaagagttcgagaaaaagttagatatcaagatcacttgctcggaa
gagacagagcctttgggcacagcagggccactggctttagctcgtcatatattgagagat
gactctgatgagccctttttcgtcctcaatagtgatgttatatgtgactacccgttgaaa
gaaatgattgagtttcacaaatcccatggtgggcaagcttccattatggttacgaaggtt
gatgaaccatcaaaatatggtgtggtcgtcatggaagaagggactgggagagtcgaaacg
tttgtagaaaaaccaaaaatattcgtgggtaacaagatcaacgctggaatttacttgttg
aacccttctgttttggatcggattgagttgaggcccacctcaatcgagaaggaggtcttc
cccagcattgcagcagagaagaagctccacgccatggttctacccgggttttggatggac
attggtcagccaaaggattacattacaggcttgagactgtacctggattccttgaggaaa
aggtcctcacctgatttgggtgttgggccacatattcttggaaacgtgttaatagacgag
agtgctgtaataggagatggatgtcttattggcccagatgtggcgattggtcccggatgt
gttattgaatctggagttaggctttcatgttgtactataatgcgtggtgtacgaattaaa
aagcatgcctgcatctcatttagcattgttggatggcactcaactgttgggcgatgggct
cgagtagagaacatgacaatcttaggagaagatgttcatgttggcgatgaagtctacagc
agtggaggtgttgttctaccgcacaaagagataaaatccagcattctgaagccagagatt
gtcatgtga

DBGET integrated database retrieval system