KEGG   Nicotiana attenuata: 109229729
Entry
109229729         CDS       T05870                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nau  Nicotiana attenuata
Pathway
nau00100  Steroid biosynthesis
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Module
nau_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109229729
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109229729
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 109229729
NCBI-ProteinID: XP_019250816
UniProt: A0A1J6I8Y9
Position
7
AA seq 369 aa
MDLNYLFNSLSPSWTSAAMLLSFFLYLATVGSILPGKLVPGVTLSDGTRLHYRCNGLLSL
LLFVLLLGVGAQMNLVSPTAIADRGLELLSTTFIFSVLVTLLLYLAGCNSREKSSSLKPH
VSGNLIDDWWFGIQLNPNFIGIDLKFFFVRAGMMGWLLINLSVLAKCILEAKLSQSMILY
QLFCGLYILDYFFYEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLSNKVELT
TAAVIANCLVFLIGYLVFRGANKQKHMFKKNPKAPIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSAVPYFYPIYLLILLIWRERRDEARCAEKYKDVWTEYRKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgaattatctattcaactccctttctccctcatggacttcggctgctatgtta
ctctcattttttctttatttagctaccgttggatctattttacccggaaaacttgttcct
ggggtgactttatctgatggaactcgcctccattaccgttgcaatggtttgttatcactt
ctgttgtttgttttgcttcttggagttggggcacagatgaatcttgtttcacctactgca
atagcagacagagggcttgagcttttgtccacaacatttatctttagtgttcttgtgaca
ttgttgctttatttggctggctgcaactcacgtgagaagagttcgtcactgaaacctcat
gtctcaggaaatctaattgatgactggtggtttgggatacaactaaatccaaatttcatt
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtattctagaggccaaattgagccaatcaatgattctctac
cagctattttgtgggctgtacatccttgattacttcttctatgaagagttcatgacctcc
acatgggatataatagcagagaggttgggcttcatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaaagtggagctaaca
acagcagcagtaattgccaattgcctcgtctttcttattgggtacttagtgttcagaggt
gccaacaagcagaagcatatgtttaaaaagaatcccaaggcacccatatggggtaagcct
ccaaaagttattggggggaagttgctcgcttctggctattggggcattgctcgacactgt
aattaccttggagatttgttgctggcattgtcatttagtttgccttgtgggataagttcc
gcggttccatacttttaccccatataccttcttattctgctaatatggagggagagaagg
gatgaagctcgatgtgcagagaagtacaaagacgtgtggacagaataccgtaaacttgtt
ccttataggatcttaccttatgtttactag

DBGET integrated database retrieval system