KEGG   Nicotiana attenuata: 109230175Help
Entry
109230175         CDS       T05870                                 

Definition
(RefSeq) probable protein S-acyltransferase 6
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
nau  Nicotiana attenuata
Brite
Enzymes [BR:nau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109230175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC ABC2_membrane_4
Motif
Other DBs
NCBI-GeneID: 109230175
NCBI-ProteinID: XP_019251243
Position
7
AA seq 137 aa AA seqDB search
FVQRNYRLYVLLLLMATVYFVYIFAFSCQKIQHKYAGNGMGLIGLVKDCPETLALTCFSF
AAAIFVGGLTSYHVYLIATNQTAYENFRQLYGSTKNPFDKGVVNNIKEILLSPWTPSRIN
FRSEICSFDHLEHVTEP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
tttgtgcagaggaattatcgactttatgtattgctattgcttatggcaactgtttacttc
gtctacatatttgccttctcatgccaaaagattcaacataagtacgctggcaatggcatg
ggattgattggtttggtaaaagattgtcctgagacattggcattgacatgtttcagtttt
gctgctgcgatttttgttgggggattgactagttaccatgtgtatctgattgctacaaat
cagacagcttatgagaattttaggcagctgtacggaagcactaaaaatccctttgacaaa
ggagttgtgaataatattaaggagattttactttcaccttggacgccttcaaggatcaat
tttcgttcagaaatatgtagctttgatcatttggaacatgtcacagaaccttga

DBGET integrated database retrieval system