KEGG   Nicotiana attenuata: 109230401Help
Entry
109230401         CDS       T05870                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109230401
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109230401
Protein kinases [BR:nau01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109230401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PIP49_C Pkinase_fungal APH YukC DUF4342
Motif
Other DBs
NCBI-GeneID: 109230401
NCBI-ProteinID: XP_019251458
Position
1
AA seq 358 aa AA seqDB search
MLALYEFYSSSQIERENQARVEKFLEDYRALRPTRYTYADIKKITNMFHERLGEGAYGVV
YKGTLSNEIHVAVEVLNDSIGNGEEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEY
LPNQSLDKFIFPASSKDHITLNWKKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILL
DHNLNPKISDFGLAKLCSKEKSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYGFGMM
LLEMVGGRKNFDAKASNSQVNFSEWIHQQLNEGEELKIRIEEDDDTIIARKLAIIGLWCI
QWNATDRPSIKIVTQMLEGDGSNLTIPPPFTARYTTHVGAGLTECPSSEELTVISELE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactctatgagttttatagctcaagccaaattgaaagagagaatcaagctaga
gttgagaagtttctggaagactacagagctctcaggcccactagatatacttatgcagat
attaaaaagataacaaatatgtttcacgaacgattaggagagggagcttacggggttgtt
tataaaggaacactttctaatgaaattcatgttgctgtagaagttctcaatgattccata
ggaaatggggaagaatttattaatgaagttgcagcaatggggaaaatccaccacttcaat
gtggttcgcctcgttggctattgcgctgatggattcagaaacgctctcgtgtatgaatat
ttgccaaatcagtcacttgacaaattcatttttccagcaagttccaaagatcacattacc
cttaattggaagaagcttcacgatattgctatgggtatagcgaaaggactggagtatctt
catcaaggatgtgaccaacaaatccttcatttcgatatcaaaccccaaaatattctgtta
gatcataacttgaacccaaagatctctgactttggtcttgccaagttatgctctaaagag
aaaagtgttgtaaccatgactgaagctagaggaaccatgggttatattgcaccagaagta
ctatccagcaatttcgggaaagcatctcataaatctgatgtctatggctttggaatgatg
ctacttgaaatggttggagggaggaagaattttgacgcaaaggccagtaatagccaagtg
aacttttctgagtggattcatcaacagctgaatgaaggagaagagttgaaaatcaggata
gaggaagatgatgataccataattgcaaggaaattggctattataggactttggtgcatc
caatggaacgcaactgatcgaccttccattaaaattgttacacaaatgctagaaggagat
gggagcaatctaactattcctcctccttttacagcaagatacaccacccacgtaggagct
ggactgactgaatgcccttccagcgaagagttgaccgtaatatcagaactagaatga

DBGET integrated database retrieval system