KEGG   Nicotiana attenuata: 109230408Help
Entry
109230408         CDS       T05870                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109230408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH YukC
Motif
Other DBs
NCBI-GeneID: 109230408
NCBI-ProteinID: XP_019251467
Position
1
AA seq 343 aa AA seqDB search
MKDLAHSYFFFWFWNFSLDDHNQVAQRHVLRVLTRIISWILPIFGLSVVARIILFPCIFV
FLMIELRRRHLSIFDAIESFLHSENNVMPIRYPYSNIRKMTRNFKEKLGQRGYGSVYKGK
LRSGPDVAVKILSKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSRRALVYDFMPNG
SLDKYITPREGGTLLSWKRKSEIALGAARGIEYLHRGCDIQILHFDIKPHNILLDENFVP
KIADFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEMAG
LKRNSAAREDMSSQYFPYWIYDQFDKEKEIKVLDEMHHDEKRS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctcgctcattcatacttttttttttggttctggaatttctctttggatgac
cacaatcaagttgctcaaagacatgttctccgcgttcttacaagaatcatctcatggata
cttcccatatttggacttagcgttgtggcaagaatcatactattcccatgcatatttgtg
tttctaatgattgaattacgaagaaggcatttgtcgatttttgatgcaattgaaagtttc
ctgcatagtgagaacaatgtcatgcccattcgatacccctactccaacataaggaagatg
actaggaattttaaggagaaactaggccaacgaggttatggttcagtatataaaggcaag
ctccgaagtggtcctgatgtagcagtgaagatcttgagcaagcctaaagctgatgggcaa
gacttcatcaatgaggttgccacaatcgggaggattcatcatgttaatgtagtacaactt
attggctattgtgctgagagatctagacgtgccctcgtatatgactttatgccaaatgga
tcacttgacaagtacatcacaccccgagaaggaggaactctactaagctggaaaagaaag
tctgaaattgctcttggagctgctcgaggtattgaatatttgcatcgaggttgtgacata
caaattctacattttgacatcaagccgcacaacatacttttggatgagaatttcgttcca
aaaattgctgactttggtcttgccaaattatacccaacggataacagcattgttactcta
acagcagcaaggggaacaattggatatgtagctccggagttgatcaacagaagcattggt
cccatatcttataaggcagatgtttatagctttggaatgctacttattgagatggcaggc
ttgaaaagaaactcggcagcaagagaggatatgtcaagccagtatttcccatattggatc
tatgatcaattcgacaaggaaaaggaaattaaagtactagacgagatgcatcatgatgaa
aaaagatcataa

DBGET integrated database retrieval system