KEGG   Nicotiana attenuata: 109231677Help
Entry
109231677         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein LOC109231677
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nau  Nicotiana attenuata
Pathway
nau00630  Glyoxylate and dicarboxylate metabolism
nau00710  Carbon fixation in photosynthetic organisms
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
nau01200  Carbon metabolism
Module
nau_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nau_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nau_M00532  Photorespiration
nau_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109231677
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109231677
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109231677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large G-patch G-patch_2
Motif
Other DBs
NCBI-GeneID: 109231677
NCBI-ProteinID: XP_019252865
Position
8
AA seq 359 aa AA seqDB search
MEEIGAAQGYEHGNGLGKNLQGITKPIQLKRHDTTFGLGERDKLNKYGRPLLGCTIKPKL
GLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGH
YLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMH
AVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDR
SRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAV
ANRVALEACVQARNEGRDLAQEGNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatcggtgcagcacaagggtatgaacacggcaatggtctcggcaagaatctc
caagggattaccaaaccaatacagctaaagcgtcacgacacaacttttgggcttggtgaa
agagataaattgaacaagtatggtcgtcccctgttgggatgtactattaaacctaaattg
gggttatctgctaaaaactacggtagagctgtttatgaatgtcttcgcggtggacttgat
tttaccaaagatgatgagaacgtgaactcacaaccatttatgcgttggagagatcgtttc
ttattttgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaagggcat
tacttgaatgctactgcaggtacatgcgaagaaatgatcaaaagagctgtatttgctaga
gaattgggcgttccgatcgtaatgcatgactacttaacggggggattcaccgcaaatact
agcttggctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcat
gcggttattgatagacagaagaatcatggtatccacttccgggtattagcaaaagcgtta
cgtatgtctggtggagatcatattcactctggtaccgtagtaggtaaacttgaaggtgaa
agagacataactttgggctttgttgatttactgcgtgatgattttgttgaacaagatcga
agtcgcggtatttatttcactcaagattgggtctctttaccaggtgttctacccgtggct
tcaggaggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattcc
gtactacagttcggtggaggaactttaggacatccttggggtaatgcgccaggtgccgta
gctaatcgagtagctctagaagcatgtgtacaagctcgtaatgaaggacgtgatcttgct
caggaaggtaatgaaattattcgcgaggcttgcaaatggagcccggaactagctgctgct
tgtgaagtatggaaagagatcgtatttaattttgcagcagtggacgttttggataagtaa

DBGET integrated database retrieval system