KEGG   Nicotiana attenuata: 109231795Help
Entry
109231795         CDS       T05870                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
nau  Nicotiana attenuata
Pathway
nau00906  Carotenoid biosynthesis
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Module
nau_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    109231795
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     109231795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 109231795
NCBI-ProteinID: XP_019252978
UniProt: A0A1J6IFL7
Position
8
AA seq 587 aa AA seqDB search
MHTILPNHSLPKPHNSPSFSCKILINPSKKNTITLPRRHTPPFLPPLPPPSPPPLAEPKL
FSLKFEPPKLNPLQKLASLALDMLEKSVITQLEKKHKLNRTVDPEIQLEGNFAPVQECPV
QHGLEIVGHIPSTLTGVYVRNGANPLFEPINGHHLFDGDGMIHAVKLDSVNNKASYSCRL
TRTSRLVQEAALGRPVFPKPIGELHGHLGLARLALFFARASFGLVDATKGTGVANAGLVY
FNGRLLAMSEDDLPYCVRITDDGDLETNGRYNFDGQIDDPLIAHPKVDPITGELHTLSYN
VLKKPYLKFFKFDTCGNKSRDISISLQNPTMIHDFAITENHVIIPDYQVVFKLSDMLLGG
SPVVHDPNKVSRFGVLSKDDQDESRIRWIEVPNCFCMHLWNAWEEISEDEGETLVIIGSC
MSPSDSIFSGSDESLKSELSEIRLSLKTGKSTRRVIVSGMNLEAGQVNKNKLGRKTRYAF
MAIADPWPKCSGLAKVDLVTGNVTKVLYGDEKFGGEPYFVLGTKEGKEDEGYLMSYVRDE
IKEKSELVIVNASNMKQVASVKLPKRVPYGFHGTFVSSQDLCNQSSC
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaatcctaccaaaccattctcttcccaaaccccacaattctccatctttttct
tgtaaaattctcattaatccttctaaaaaaaatactataacacttcctagaagacatact
ccaccgtttctaccaccgctgccgccaccgtcaccgccacctttggctgaacctaaatta
ttttcattaaaatttgaacctccaaaattgaaccctcttcagaaacttgcatctttagcc
ttggacatgttagaaaaatctgtgataacacagctggaaaagaaacataagctgaaccgg
acagttgacccggaaattcagctagaagggaattttgcaccggttcaagaatgcccggtt
cagcatgggcttgagatagttggtcatattccgtctactttaacgggggtttacgttaga
aatggtgctaacccattatttgaaccgattaacggtcatcatttatttgacggtgacggg
atgattcatgccgttaaattggattcagttaataataaagctagctactcatgccggtta
actcgaaccagccggttggttcaagaagctgcattgggccgaccggtttttcctaagccg
attggcgagttgcatggccatttggggttggctcggctcgcgctgttcttcgcccgagct
agtttcgggttggtagatgctaccaaaggaaccggcgtagcaaacgccggtctggtttat
tttaacggccggcttttagctatgtcggaggatgatcttccgtattgcgtccgtattaca
gatgacggtgatcttgaaactaacggacgttacaattttgacggacaaattgatgatcca
ttgattgcacatcccaaggtggaccccatcacgggggaacttcataccttgagttacaat
gtattgaaaaagccttaccttaaattcttcaagtttgacacgtgcggtaataagtcacgt
gacatttctatttccctccaaaatccaaccatgattcatgactttgccatcacggaaaat
cacgtgatcattccggattatcaggtggtattcaagttatccgatatgttactgggtgga
tcgcccgtagtccacgacccgaataaagtttctaggttcggcgtattgtcgaaagatgac
caggacgaatcaagaattcgatggattgaagttcccaattgcttttgcatgcacttatgg
aatgcatgggaggagataagcgaagacgagggtgaaaccctagtgattatagggtcatgc
atgagtccatcagattccattttttcaggaagcgatgaatcattaaaaagtgaactatct
gagattcgattaagcttgaaaacgggcaagtctacacgacgggttatagtatcggggatg
aacctagaagcggggcaagttaacaagaataaacttggccgaaaaactcggtatgcattc
atggcaatagctgatccatggccaaaatgtagtggcctagcaaaagtcgatttggtcacg
ggaaatgttacgaaagttttatacggagatgaaaaatttggaggtgaaccctatttcgtg
ctcggcacgaaagaaggaaaagaagatgaagggtatcttatgagttatgttagagatgag
ataaaagaaaaatcagagttagttatagttaatgcttcaaatatgaagcaagtggcctca
gtaaaattacctaaaagagtgccatatggttttcatggtacattcgttagttcacaagat
ttatgtaatcaatcttcttgttaa

DBGET integrated database retrieval system