KEGG   Nicotiana attenuata: 109232015Help
Entry
109232015         CDS       T05870                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 4-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nau  Nicotiana attenuata
Pathway
nau00520  Amino sugar and nucleotide sugar metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109232015
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     109232015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 109232015
NCBI-ProteinID: XP_019253188
Position
9
AA seq 424 aa AA seqDB search
METERKKDMLSKKGLFLKYPMNYVFEEQRMVCLLIGIAISTAAFAVVNSVSSPSLLAGYK
IGSDSISDVSVVSTSLIPRRITYELVDEANRNINAGGKVPLGLKKKKLRVLVTGGAGFVG
SHLVDRLIERGDSVIVVDNFFTGRKENLLHHFRNPKFEMVRHDVVEPILLEVDQIYHLAC
PASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQVETYWGN
VNPIGVRSCYDEGKRTAETLAMDYHRGLNVEVRIARIFNTYGPRMCIDDGRVVSNFVAQA
LRKQPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGDHVGPFNLGNPGEFTMLELAKVVQET
IDPNAKIEFRANTEDDPHKRKPDISKAKQLLGWEPTVSLRQGLPRMVDDFRQRIFGDEKL
NSGL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaacgtaagaaggacatgttgagcaagaaagggttatttttgaaataccca
atgaattacgtgtttgaagagcagcgaatggtttgtttattaatcggaattgccatttca
actgcggctttcgctgtggttaattctgtttcttctccttcgttgttggccgggtacaag
atcggtagtgattcgatttcggacgtttcggttgtgtcaacttctttgattcctcgtaga
ataacgtacgagttggtcgatgaagctaaccgcaacattaatgcaggtggaaaggtgcca
ttaggattgaagaaaaagaagttgagagtattggtaacaggtggagctggttttgttggg
agccatttggtggataggttgatagagagaggggatagtgtgattgtggttgataatttc
ttcactggtcggaaggagaatttgttgcaccatttcagaaaccctaaattcgagatggtt
agacatgatgtggtggagccaattttgcttgaagttgatcagatttatcatttggcttgc
cctgcttctcctgttcattacaagtataatcctgtcaagaccatcaaaacaaatgtgatg
ggaacattgaacatgttggggctggcaaaaagagtaggagcacgatttctgctcactagc
accagtgaagtgtatggtgatcctttgcagcatcctcaagtcgaaacttactggggcaat
gttaatcccattggtgtccgaagttgttatgacgaaggaaagcgaacagctgagactttg
gccatggattaccatagaggacttaacgttgaggttagaattgctaggatattcaacaca
tatggaccgcgtatgtgcatagatgatggtcgggttgtgagcaatttcgtggcccaggcc
ttgagaaagcagccattaactgtttatggagatggtaagcaaactcggagtttccagtat
gtttcagatttggtagaaggattgatgaggttgatggaaggggatcatgttggtcctttc
aatcttggaaaccctggtgaatttaccatgcttgaactagctaaggtggtgcaagaaaca
atagatccaaatgcaaagatagaatttagggcaaacacagaagatgatccccacaagagg
aagcctgacatttcaaaagcaaagcaacttttaggatgggagccaacagtttcccttcgc
caaggtttacctcgcatggttgatgactttcgacaacgtatatttggcgatgaaaagctc
aattctggcttataa

DBGET integrated database retrieval system