KEGG   Nicotiana attenuata: 109232018Help
Entry
109232018         CDS       T05870                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
nau  Nicotiana attenuata
Pathway
nau00562  Inositol phosphate metabolism
nau01100  Metabolic pathways
nau04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109232018
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109232018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nau01009]
    109232018
Enzymes [BR:nau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     109232018
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     109232018
Protein phosphatases and associated proteins [BR:nau01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    109232018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase Fez1 Y_phosphatase3 HAUS-augmin3 EzrA
Motif
Other DBs
NCBI-GeneID: 109232018
NCBI-ProteinID: XP_019253191
UniProt: A0A1J6IHM3
Position
9
AA seq 851 aa AA seqDB search
MYRSRSARSPNLREPEVRLAESDKIEGAGGWDALEWTKIDPVSRSVPIGVKQFLLEDEHV
VVEGYGVVLVNTDDAGTLFVTNFRLLFLSEGSRDIITLGTVPLATIEKFQKIVMKLPSGQ
RQPEKTGSQRLLQIIGKDMRIIVFGFRPRTKQRRAVYDALLRCARPARLWDLYAFAGGHS
RFSNTNPKVRLLNEYCRLLGMGFCQASIRAIEDGSFTLSNEYWRISSVNSNYTMSPTYPF
ALLLPKSISDDKVLQACTFRARCRLPAITWCDRGTGAVLARSSQPLVGLMMNMRSNADEN
LVAALCTQIAGEKRRKLYIADARPRKNALANGAMGGGSESSANYFQSEIVFFGIDNIHAM
RESLGRLRDYLDTHGTTSSDGMSSFLRHGGWSWGGGNLSSMSASVSTLGDTGWLIHVQTV
LAGSAWIAARVALESASVLVHCSDGWDRTTQLVSLASLLLDPYYRTIKGFQALVEKDWLA
FGHPFSDRLGMPTISGSGNMPFELSRQASTGSLPSSPMRQVSGSSSSQAQSTSHAQNQSS
PIFLQWVDCVSQLLRMYPFAFEFSSAFLVDLLDCMLSCRFGNFLCNSEKEREQAGISDAC
GCLWMYLAELRASEGSSHAHYNLFYDPLKHDGPLLPPAAALAPTVWPQFHLRWACPSEAQ
GGEVEAECRKLTRKFSELQRAKEAAETRLNEISVTVESLVTELRNEKLVSNSARDAVKRA
SKETATIKRAVQSLGFNVYFSVDGDCNVCIESNPTEIPQRSVCSVSTTNSNGSVHGSEKS
DLSEPVTVMQDDVSDNPLIQVCESLCPMHSRDSGCRWPNPGCAKFRSQFVGLKANFDAFD
RLPIYDNYFGT
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggagtcggtcggcgcgatctccaaacctccgtgaaccggaggttcgactcgct
gagtccgataaaattgaaggtgccggtggttgggacgcccttgaatggactaaaatcgat
cctgtttcgaggtcggttccaattggagtgaaacaattcttgctggaggatgagcatgtt
gtagtagagggttatggggtagttcttgtcaacactgatgatgctggaaccttatttgtg
actaattttcgcctccttttcttgagtgaagggtctagagatatcattacacttggcaca
gtaccattggcgaccattgagaagttccagaaaattgttatgaagcttccatcaggtcag
cgtcagcctgaaaagactggttcacagcgattgcttcagatcattggcaaagatatgaga
atcattgtctttggttttcgtcctcgaaccaagcagaggcgtgctgtctatgatgcatta
ttacggtgtgcaaggcctgcaaggttatgggatctctatgcatttgccggtggccattcc
aggtttagtaacacgaatcccaaagtaaggctgttgaatgagtactgccgacttcttgga
atggggttctgtcaagcttctatccgtgctattgaagatgggtcattcacactctcaaat
gagtattggagaataagcagtgttaactctaattacacaatgtctccaacttatccattt
gcgttactcttaccgaagtccataagtgatgacaaagtgctgcaggcttgtacattccgt
gcacggtgtaggctgccagccataacatggtgtgacagaggaactggggctgttcttgca
cgttcttctcaaccactagttggcctcatgatgaatatgagaagcaatgcagatgagaat
ctagttgctgcactgtgtactcaaattgctggagagaaacggaggaagctatatattgct
gatgcaaggcccaggaaaaatgctttagcaaatggggcaatgggaggtggatcagagtca
tctgcaaactattttcagtctgagattgttttctttggcatcgataatatacatgcaatg
agggagagtcttggtcggcttagagactatttagatactcatggtactacttcatcagat
ggaatgtcgtcttttctgaggcatggtggatggagttggggcggaggcaatctcagcagt
atgtctgcttcagtttctacactgggggacactgggtggttaatacatgttcaaactgtc
ctggctggttctgcttggattgctgcacgtgttgcactagaatcagcttcagttcttgtt
cattgcagcgatggatgggatcgaactacgcaattggtctcacttgccagcttgctactt
gacccatactatcgtacaattaaaggatttcaggcacttgtagagaaagattggcttgca
tttggtcatccattttcagatcgtctgggaatgcccactatatctggaagtggcaacatg
ccgtttgaattatctcgtcaggcttcgactggcagtttaccttcatcacccatgcggcaa
gtatcagggtcatcctcatctcaagctcaaagtacatctcatgcacagaaccaaagttcc
cccattttcttgcagtgggttgattgtgtttcacagttgttaaggatgtacccttttgcc
ttcgagttctcttcggctttcctggtggatcttctggattgcatgctttcttgccgtttt
ggaaactttttgtgcaacagcgagaaggaaagagagcaagctggtatttctgatgcttgt
ggatgcctgtggatgtatttagctgaactacgggcatcggaaggaagctctcatgcgcat
tacaacctgttctatgacccgttgaaacatgatggtccgctactaccaccagcagcagct
ttagctccaactgtttggcctcagtttcaccttcgttgggcttgcccgtcagaggcacaa
ggtggagaagttgaggcagaatgcaggaagctgacgagaaaattctctgagctgcaaagg
gcaaaagaagcagcagaaacaagactgaacgaaataagtgtcacagtggagtccttagtt
acagaattgagaaatgagaaacttgtgagcaactctgccagggatgctgtaaaaagagcc
agcaaagaaactgctactataaagcgtgcagtacaatctttgggttttaatgtctacttt
tcagtagatggagactgtaatgtatgcattgaaagcaacccaacagaaattcctcagcgt
tctgtctgctcagtttctacaacaaattctaatggttcagtacatggcagtgagaaatca
gacctctctgaacctgttacagtgatgcaagatgatgtttccgacaatcctctcatccaa
gtttgtgaatcgttgtgccctatgcacagtagagacagtggttgcaggtggccaaatcct
ggttgtgccaagtttcggagccaatttgttggtttgaaggccaactttgatgcatttgat
cgccttccgatatacgataattatttcgggacttaa

DBGET integrated database retrieval system