KEGG   Nicotiana attenuata: 109232259Help
Entry
109232259         CDS       T05870                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nau  Nicotiana attenuata
Pathway
nau00010  Glycolysis / Gluconeogenesis
nau00562  Inositol phosphate metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109232259
   00562 Inositol phosphate metabolism
    109232259
Enzymes [BR:nau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109232259
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109232259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109232259
NCBI-ProteinID: XP_019253503
UniProt: A0A1J6I0X4
Position
9
AA seq 494 aa AA seqDB search
MLKNLIILLLLPVFLQSNADESSFDVRKHLATVSRYNVAKDISANSFVSSEIPDQCVPLH
LNLVARHGTRAPTKKKIRELETLAAHLKVLLRDAKEHKQSLEKIPAWLLGWSSPWKGKLT
GGELISEGEDELYHLGIRVGEKFPDLFSEEYHPDVYSIKTTQVPRASASAVAFGMGLFNG
RGKLGPGRHRAFAVTSESRASDIVLRFHDCCQSYKAFRKSQEPNVDKLKEPVLDEITREL
VRQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFSPSEVSLLEWTDDLELFILKGYG
DSLNYRMGVPLLEDVVHSMEQAIKAKEEGYARGTYEKARMRFAHAETLLPFSCLIGLFLE
EPEFELIQREQSLELPQKPPKSRNWRGSVVAPFAGNNMLVLYSCQLDNSSKYFVQVLHNE
RPVALPGCNSSSFCPFEVFKERIAAPHLKHDYNMLCNANMQQGQQNSASSKLSRIFSWLF
SLKNTGSSAQKVEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaatctcatcatactgctactcctccctgttttcttacaatcaaacgctgat
gaatcctccttcgatgttcgtaaacaccttgccactgtatccaggtataatgttgccaag
gacatatcagcgaattcattcgtatcttctgaaattccagatcaatgtgtacctcttcat
ttgaatctagtggcaaggcatggcactcgtgcaccaacgaagaaaaagataagggaatta
gaaaccttggctgctcatttgaaagtccttttacgtgatgcaaaagaacataagcagtct
ttggagaaaattcccgcttggttattggggtggagctctccttggaaaggaaaacttaca
ggaggagagttgatcagtgaaggagaagatgaattatatcatcttggaatcagagttggg
gaaaaatttccagaccttttcagtgaggaataccacccagatgtatattcaatcaagact
acccaggttcctcgggcatcagctagcgctgtggcatttgggatggggctttttaatgga
agagggaagcttggaccaggaagacatcgagcttttgctgttaccagtgaaagccgtgca
agtgacatagttttgagatttcatgattgttgtcaaagctacaaggcttttagaaaaagt
caggagccaaatgtagacaagctcaaagaacctgtattggatgaaattactcgtgaatta
gtcaggcaatatgggcttaattttacgaaacaagatgtatcttctttatggtttctctgc
aaacaggaagcatccttgttgaacatcaccaatcaagcttgtagtctgttcagtccatct
gaggtttctttgttggagtggactgatgatttggagttgttcattctgaaaggctatggt
gattcactaaattatcgaatgggagtgccactgcttgaggatgttgttcactcaatggaa
caggcaattaaggctaaagaagaaggatatgctcgagggacctatgaaaaggcaagaatg
cggtttgctcatgcagaaactctgcttcccttttcatgcctgatcgggctctttcttgaa
gaacctgagtttgaactaatacaaagagagcaaagcttggaacttcctcagaagcctcct
aaaagtagaaactggcggggaagtgtagtggctccttttgccggaaataacatgttagtc
ctttacagctgccaattggacaactctagcaagtactttgtgcaagtgctacataatgaa
cgtcccgtcgcattgccaggttgcaatagttcaagtttttgcccatttgaagtatttaag
gaaagaatagctgctcctcacttgaaacatgactataatatgctttgcaacgcaaacatg
caacagggacagcagaattctgcttccagtaagttatcaagaatatttagttggcttttc
tcgctgaagaacactggttcatcggcccagaaagtcgagttatag

DBGET integrated database retrieval system