KEGG   Nicotiana attenuata: 109232815Help
Entry
109232815         CDS       T05870                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nau  Nicotiana attenuata
Pathway
nau00480  Glutathione metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109232815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nau02000]
    109232815
Enzymes [BR:nau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109232815
Transporters [BR:nau02000]
 Other transporters
  Pores ion channels [TC:1]
   109232815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 109232815
NCBI-ProteinID: XP_019254081
UniProt: A0A1J6IUZ3
Position
9
AA seq 221 aa AA seqDB search
MEEVKLHGTCYNLFTYRVIWALKLKGIPFDYIEEEHSDKCPLVLKYNPAFKRFPVLFHGK
KALSESMVILEYIEDTWPQNPLLPIDPIDRAMSRFWVKFAGDKGHCIGTMYYTIGEKQEK
AIKETMEMLTIIEEKALVGEKEFFGGEKIGIVDLAFGIIPHWLEVIEDIVGVKLLEPHSF
PRLLNWVQNFKEETVIKENLPNRDDMFVFLKNQREMLLSSS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtaaagctccatggaacttgttataatttgttcacttatagggttatttgg
gctctaaagctaaagggaataccttttgactacatagaagaggaacattctgataaatgt
cctttagttttgaaatataatccagcttttaagagatttccagtgctttttcatggtaaa
aaagcactttctgaatccatggttattcttgaatatattgaagatacttggcctcaaaat
ccacttcttcccattgatcccattgatagagccatgtcaagattttgggttaaatttgct
ggagataagggacattgtattgggacaatgtactacacaattggagaaaagcaagaaaaa
gccatcaaagaaacaatggaaatgcttacaattatagaggaaaaagctcttgttggagaa
aaggaattctttggtggtgagaaaattggaattgtggacttggcttttggtataattcct
cattggcttgaagtaattgaagatattgttggtgtgaaattgttggaacctcactcattt
cctcgtttgctcaattgggttcagaatttcaaagaagaaacagtcattaaagagaatctc
cctaatcgtgatgacatgtttgtgtttttaaaaaatcaaagagagatgctattgtcatct
tcttga

DBGET integrated database retrieval system