KEGG   Nicotiana attenuata: 109232895Help
Entry
109232895         CDS       T05870                                 

Definition
(RefSeq) pollen receptor-like kinase 1
Organism
nau  Nicotiana attenuata
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_4 LRR_8 LRRNT_2 PGF-CTERM EphA2_TM DUF4064 DUF5305 DUF5383 DUF4448 SARAF
Motif
Other DBs
NCBI-GeneID: 109232895
NCBI-ProteinID: XP_019254131
UniProt: A0A1J6HYM6
Position
10
AA seq 648 aa AA seqDB search
MAQTTQKNYKIKNKNNQNYKHLPFLFVIAFLLAFVTTPSDGKLSEAEILLKFSQSLKYDG
NPFSTWNANVPPCVKGNNKPNWNSLFCEGGMVYGLNLENLGLSGTLDVDTLKELPNLRTI
SVLSNNFEGSLPPLNKLPALKSAYFSNNKFSGPIDGKTFEGMNSLKKLHLANNQFTGQLP
PIFGELPKLVELNVQNNKFEGPIPSSLSRLYFSAFQGNDGLCGPPLTKSCNEEAPKKQES
SSSSSGWKIALIVVVVVAVIGLIAVVLITRRKKNNSQQEVTLGSSNISPTTHEPKLTSAD
LNKLEQGQVAASPDRSNDGKRAEQGQKLLFLKDDIEKFDLPDLLKASAEVLGSGVFGSTY
KAALSTGPVMVVKRFRHMNKVGKEDFHEHMRRLGRLSHKNLLPVLAFYYRKEEKLLVFEY
VNNVSLAVYLHGNSKSRGNQSLDWPTRLKIVKGVAKGILYLYNELPSITAPHGHLKSSNV
LLTETFEPVLTDYALLPVVNIEHAQEHMISYKAPEYKLSGKINRKTDVWTLGMLILEILT
GKFPSNLLGKGSHDTDDLATWVNSVLGEDSSKEEVFDKEMKGTQDCEGEMMKLLKVGLSC
CEADVEKRWDIKEAVEKIEEVKEKGAAGDGDFFSSVAVSDETDMHNSR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaactacacaaaaaaactacaaaatcaaaaacaaaaacaaccaaaactataaa
catctccccttcctcttcgttatcgcgtttttactagcatttgtaaccaccccatcagac
gggaaattatcagaagctgagattctgctcaagtttagtcaatctttaaaatatgatggc
aatcccttttcaacatggaatgccaatgtaccaccttgtgtcaaagggaacaataagcca
aattggaatagtcttttttgtgaaggtggtatggtttatggtttgaatcttgaaaatctt
ggtttaagtggtacccttgatgttgacacgttaaaagagttgcctaatttgagaaccata
agtgtattgagtaataattttgaagggtctttgccacctttgaataagctacctgcatta
aaaagtgcttatttttcaaacaataaattttctgggccaattgatggcaagacttttgaa
gggatgaattcgttaaagaagctacacctagcaaataatcaatttacaggacaactccct
cccatattcggtgaattgccaaagctcgtggagttaaatgtacaaaataataagtttgag
ggtccaattccttcttccctttctcgtctatatttttctgcttttcaaggaaatgatggt
ctttgcggtccacctttaacaaaatcatgcaatgaagaggcaccaaaaaagcaagaatca
tcatcatcatcttctggttggaagattgcccttatcgtcgtggtggttgttgctgttata
ggtctaattgccgttgtactcataactcgtcgcaagaaaaataattcccaacaggaagtt
actctaggatcatcaaatatatcaccaacaactcatgagccaaaactcacatcagctgac
ctaaacaaattggaacaaggccaagttgctgcatctcctgatcgttctaatgatggaaaa
agagctgaacaaggacaaaagcttttgttcttgaaagatgacattgagaaatttgacttg
ccagatttattaaaggcctcagctgaagtattgggcagtggtgtgtttggttcaacttat
aaagctgcacttagcactggtcctgttatggttgttaagaggtttagacatatgaacaaa
gttggcaaggaagatttccatgagcatatgagaagacttggtagattgagccataagaac
ttgcttcctgttctagctttctattataggaaggaggagaagcttttggtctttgaatac
gtcaacaatgtcagccttgccgtttatcttcatggcaatagtaaatcacgtgggaaccaa
agcttggattggccaactcgcttgaaaattgtaaaaggagtagccaaaggaattttatac
ctctacaatgagctaccaagcataactgcacctcatggtcatctcaagtcctcaaatgtc
cttctaactgaaacctttgagccagttctcacagattacgccttactaccagtcgtaaat
atcgaacatgctcaagaacacatgatctcatacaaagcaccagagtacaagctatctggc
aaaatcaacaggaaaactgatgtttggacacttggtatgttgatcctagaaatcttgact
ggaaaatttccttcaaatcttttaggcaaagggagtcatgataccgatgatttggcgact
tgggtgaactctgtacttggagaggattcatcaaaagaagaggtgtttgataaggaaatg
aaaggaacacaagattgtgagggtgaaatgatgaaactattgaaggttggtttaagttgt
tgtgaggctgatgtggagaaaagatgggatataaaagaggctgtggagaaaattgaggaa
gtaaaagaaaaaggtgctgcaggagatggtgatttcttctcttctgttgctgtaagtgat
gaaactgacatgcataattcaagatga

DBGET integrated database retrieval system