KEGG   Nicotiana attenuata: 109232960Help
Entry
109232960         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein At4g19900
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
nau  Nicotiana attenuata
Pathway
nau00601  Glycosphingolipid biosynthesis - lacto and neolacto series
nau00603  Glycosphingolipid biosynthesis - globo and isoglobo series
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    109232960
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    109232960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nau01003]
    109232960
Enzymes [BR:nau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     109232960
Glycosyltransferases [BR:nau01003]
 Glycan extension
  P blood group
   109232960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 109232960
NCBI-ProteinID: XP_019254210
Position
10
AA seq 458 aa AA seqDB search
MDIVINNTKRITISNLSPFFHHCCNFQLTKRSLYAIVSCSLLFLLAYNSSTVFYIQVPVP
ANSSPEISSFLTENVARKSRKLVSLSSSTKRSSSIIYAVKEEPPRQKTNTQLTISRKNPN
FVSFTYNSMAYNPRRRREKKSLVKVLGSGARINEFSLRMKEFFGAKSYNNSCKYRFFMTW
ISSIESFGEREQFAIESLFKAHSNGCLVIMSTSMDSPKGMKILKPFFEKGLKVTAVSPDF
NYLFKHTIAQGWIDSLMEGNIDPGEVSIGQNLSNLLRLGLLYKFGGIYLDTDVIVLRSFG
KLRNVIGAQTIDVETRNWSRLNNAVMIFDKGHPLLYKFIEEFALTFDGNKWGHNGPYLVS
RVVSRVSGRDGYNFTVLPPLAFYPVDWSRIGSLFLGPRNETHSKWLLSKLRQIQSQSLAV
HLWNKQSRGLKVEEGSIIQHIMSDCCVFCNSYAAKFCP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattgtaattaataatactaagagaattaccatttctaatttgtctccgtttttt
caccattgttgtaatttccagttgactaaaaggtccttatatgcaattgtttcttgttct
ctgctttttctcttagcttacaacagttccactgtgttctatattcaagttccagttccg
gccaactcctcgccggagatttctagctttttaactgaaaatgtcgccagaaaatcaaga
aagttggtttctttatcttcttcaactaaacgctcatcttctattatatatgcagtaaaa
gaggaacccccacgtcaaaaaacaaacacccaattgacaatttcccgcaaaaatccaaac
tttgtgagttttacatataattcaatggcttataatcctagaagaaggcgagaaaagaag
tctttggtgaaagttcttggttcaggggcaagaattaatgagttctcattgagaatgaag
gagttttttggagctaaatcatacaataattcctgtaagtataggttttttatgacttgg
atttcttcaattgaatcttttggtgaaagggaacagtttgctattgagagtttattcaaa
gcacattcaaatggctgtttggtaattatgtccacttcaatggattcaccaaaaggaatg
aaaattttaaagcctttctttgagaaaggattaaaggtaactgcagtttcacctgatttt
aattacttatttaaacatactattgctcaaggctggattgatagcttaatggagggtaat
atagatccaggggaagtttctataggtcaaaacctctcaaatttgcttagacttggttta
ttgtacaagtttggtgggatttatttagatactgatgttatagtgttgagaagttttggg
aagctaagaaatgtaattggggcacaaactattgatgttgaaacaagaaattggagcagg
ttaaataatgctgtaatgatttttgataaggggcatcctttgttgtacaagttcattgaa
gaatttgcacttacatttgatgggaacaaatggggtcacaatggtccttacttggtttca
agggttgtgtcaagggtaagtggaagggatggatacaatttcacagtgttgcctccgctg
gctttttatccagttgattggagtaggattggtagtctctttcttgggccgaggaacgag
actcattcgaaatggttgctttctaaactccggcagatacagagccaaagtttggctgtg
catctttggaacaagcagagtagagggcttaaggttgaagaaggaagcataatccaacat
ataatgtcagattgttgtgttttctgcaattcttacgcagcaaaattttgtccataa

DBGET integrated database retrieval system