KEGG   Nicotiana attenuata: 109233138Help
Entry
109233138         CDS       T05870                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nau04131]
    109233138
Membrane trafficking [BR:nau04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109233138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 109233138
NCBI-ProteinID: XP_019254460
Position
10
AA seq 1836 aa AA seqDB search
METSSSGYRFRRIPRHSFAGSVNLDPLLDENLEQWPHLNELVQCYRTDWVKDENKYGHYE
SVSPASFQNQIYEGPDTDIETEMHLANARRPKIEDSIDDEIPSTSGTQLSETNFSDLSNA
KISKHFGESPLPTYEPVFDWENERSLIFGQRIPEAHMSQYTSGLKIAVKVLSLSFQAGLV
EPFYGTICLYNRERREKLSEDFIFHILPSEMQEASSSCERRCIFHLDAPSASICLLIQLE
KPATEEGGVSPSVYSRKEPVHLTEREKQKLQVWSRIMPYKESFAWAIIPLFDSNITSVAG
SASPSSPLAPSVSASSSQEGITDPVSKVTADGKLGYSNGNSIVVEVSNLNKVKEGYTEES
LQDPKRKVHKPVKGVLKLEIEKLPASSAEVENTLESGSLAYDSLDHGDHLTDSASMKRPT
NGFFSKSKSFEMKELVRNFSIAQENVENSADDFEAFDFRTTTRNEPFLQLFHCLYAYPLT
VSMSRKRNVFIRVELRKDDTDIRKSPLEAMHPREPGVPLQKWSHTQVAVGARVASYHDEI
KISLPAIWTPLHHLLFTFYHVDLQTKLEAPKPVVIGYASLPLSTHAQFRAEISLPIMKEL
VPHYLQDSAKERLDYLEDGKNIFKLRLRLCSSLYPVSERIRDFFLEYDRHTLRTSPPWGS
ELLEAINSLKNVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVNILTRVQQESVD
EAERNAFLVNFVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWF
FLELIVKSMALEQARSFYHNLPSGEDVPPMQLKEGVFRCVVQLYDCLLTEVHERCKKGLS
LAKHLNSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQTVLHDCKLTFLQIICDHDL
FVEMPGRDPSDRNYLASILIQEIFLTWDHDDLSMRAKAARILVVVMCKHEFDIRYQKQED
KLYIAQLYFPLVGQILDEMPVFYNLSTIEKREVLIIFLQIVRNLDDDSLVKAWEQSIART
RLFFKLFEECLMHFEHRKPADGMLVGSSSRSVMGDGPASPKYSDILSPAINHYMSEAARQ
EVRGTPDNGYLWQRVNSQLSSPSQPYSLREALAQAQSSRIGASALALRESLHPILRQKLE
LWEENLSAAVSLQVLEVSEKFSRTAATKHIATDYGKLDCITSIFMNVFSRNQPLSFWKAL
FPVFNNVFELHGATLMARENDRFLKQIAFQILRLAVFRNDNIRKRAVIGLQLLIRSSFSC
YMQTGRLRVMLTITLSELMSEVQVTQMKPDGTLEESGEARRLRNSLDEMADEAKSSSLLL
ESGLPENALVAVPEGSTENRWSWSEVKVLSDSLLMALDASLEHALLGSVMNVDRYAAAES
FYKLAMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVVMQALVSRNDGVWSK
DHVSALRKICPMVSSEITSEASAAEVEGYGSSKLTVDSAVKYLQLANKLFSQAELFHFCA
SILELVIPVYKSRKAYGQLAKCHTMLTNIYESILEQESSPIPFTDATYYRVGFYGEKFGK
LDRKEYVYREPRDVRLGDIMEKLSHIYESRMDGTTLHVIPDSRQVKADELQTGVCYLQIT
AVDPVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVL
QTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQS
LQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHF
RLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcatctagtggatatcggtttcggagaataccacgccactcctttgctggt
tctgtgaatttagatcccctgcttgatgaaaatttggagcagtggccacatttaaacgaa
cttgtgcaatgctatagaaccgactgggtaaaagatgagaacaagtatggtcactatgaa
agcgtcagcccagcttcatttcagaatcagatatatgagggtcctgatactgatattgaa
acagagatgcatcttgcaaatgctaggcgacctaagattgaggattcaattgatgatgaa
atccccagcacttctgggacacaactctctgaaactaatttctctgacctctcgaacgcc
aaaatctctaagcattttggtgaatcccccctaccgacttatgaaccagtttttgactgg
gaaaatgaaaggtcactaatatttgggcaaaggattccagaagctcatatgtcccagtat
acgagtggtctgaagattgccgtgaaagtcctatcattgtcatttcaagctggacttgtt
gagccgttttatggcacaatttgtttatataatagggagcgaagagaaaaactttcagag
gattttattttccatatattgccttccgaaatgcaagaagcaagcagttcctgtgaacgg
cgttgtatttttcatcttgatgctccatcagcatctatttgtctgctaatccaactagaa
aagcctgcaactgaagaaggtggagtgtctccttctgtttattcacgaaaggaaccagtt
catctgacagagagagagaaacagaagctacaagtgtggtcgcggatcatgccttataag
gagtcctttgcctgggccatcattccactctttgatagtaacattacttctgttgctggc
tctgcttctcccagcagtcctcttgctccaagcgtttcagcttcaagttctcaagagggt
atcactgacccagtttcaaaagttacagctgatggaaagcttggttattcaaatgggaac
tctattgtggtcgaagtgtctaacttaaataaagtcaaagaaggatataccgaggaatca
ctccaggatccaaagcgaaaggttcataaaccagtaaaaggtgtcttgaaattggaaatc
gaaaagctgccagctagctctgctgaagttgagaatactttggagagtgggagtctggct
tatgattctcttgatcacggagaccatttgactgattcggcttctatgaaacgccctact
aatggtttcttttctaagtctaaatcctttgagatgaaagagcttgttcggaatttttca
attgctcaggaaaatgtggaaaattctgctgatgattttgaagcttttgacttccgcacg
acgacaagaaatgaacctttcttgcagctctttcactgcttatatgcctaccccttgact
gttagtatgagtcggaaaagaaacgtgtttatacgtgttgaactgagaaaggacgataca
gacattcggaaatcacctctagaggctatgcatccaagggaaccaggtgtaccacttcag
aaatggtcacacacacaagttgctgttggggcaagggtcgccagctaccatgacgagatc
aaaatttctttgcctgctatttggacaccattgcatcaccttttgtttactttctatcat
gttgatcttcaaacaaaacttgaagccccaaagccggtggtaattggatacgcttcactt
ccattgtccacacatgcgcagttcagagctgagatttccttgccaatcatgaaagaatta
gttcctcattatcttcaagatagtgccaaggagaggctggattacttggaagatggcaag
aatatattcaagcttcgtttacgactatgttcatcattgtacccagttagtgaacgcatt
agggattttttccttgagtacgataggcacactcttcggacaagtcccccttggggatct
gagcttcttgaggcaatcaatagcctgaagaatgttgattccacagctttgcttcaattt
ctttatccgatcttaaacatgcttctccatcttattggcaacgggggagaaactcttcag
gttgctgcatttagagcaatggttaacattttaacaagggtgcagcaggagtctgttgat
gaagctgagagaaatgctttcctagtaaactttgttgattatgcttttgatgattttggg
ggtcgtcagccaccagtctatcctggtttgtccacagtgtggggaagtttggctcgcagt
aaggcaaaagggtaccgcgttgggccagtctatgatgatgtcctggcaatggcttggttt
tttcttgagctgattgtcaagtcaatggcactggagcaggctcgatccttctatcacaat
cttccatcgggtgaagatgtcccgccaatgcagttgaaagaaggtgtttttagatgtgtt
gttcaattgtacgactgccttctaacagaagttcatgaacgctgcaagaaaggtctaagc
ttggccaagcatttaaacagtagtttggctttcttttgttatgatcttttatccatcatc
gagcctcggcaggtttttgaactggtatccttgtacctcgataaattctctggagtgtgt
cagacggtgctgcatgactgcaagcttacttttctacaaattatatgcgatcacgatctt
tttgttgaaatgcccggacgagatccttctgataggaattatcttgcatctatcttaatt
caagagattttccttacatgggatcatgatgacttatcaatgagggcaaaagctgcaaga
atcctggtggtcgtcatgtgtaagcacgagtttgatattcgttaccaaaagcaagaggat
aaattatatattgctcaattatattttccccttgttggccagatcctagatgagatgcct
gtcttctacaatctgagtacaattgaaaaacgtgaagtcctgattatctttctgcaaata
gtacgcaacttggatgatgactcacttgttaaagcttgggagcagagcattgcacggacc
agattatttttcaaactctttgaagagtgcttgatgcattttgagcataggaaacctgct
gatggcatgcttgttggtagtagttctcgtagtgtgatgggggatggacctgcatcccca
aaatattctgacattctttcacctgcaataaatcattatatgtctgaagcagcgcggcaa
gaagtcagaggaactccggataatggttatttgtggcagagagtcaactcccaattaagc
tcacctagtcagccatattctttgagagaagcgttggctcaagcccaatcttccagaatt
ggagcatcagcgctagcattaagggaatctttgcacccaatcttaaggcaaaagctggaa
ctttgggaagaaaacctgagtgctgctgttagtcttcaagttttagaagtttccgagaag
ttctcacggactgctgcaacgaagcacattgctactgattatggaaaacttgactgtatc
acatctatatttatgaacgtgttctcacgtaatcaaccactctccttctggaaagctctc
tttcctgtcttcaacaatgtctttgaacttcatggagctacactgatggcaagagaaaat
gatcgcttcttaaagcaaattgctttccaaattcttcgacttgcagtttttcggaatgac
aatatcaggaaaagggctgtaattggcctgcagttacttattcggagctcgttttcttgt
tatatgcagacgggaagattaagagtcatgctaaccattacattgtcagagttaatgtct
gaagttcaagtaacacaaatgaaacctgatggcacactagaagaaagtggtgaagctcgt
cgtcttcgaaattctttggatgaaatggcagatgaagctaagagttcctccttattatta
gagtctgggctccctgaaaatgcactggttgctgttccagaaggatcgacagaaaaccgc
tggtcctggtctgaggttaaagttctttcggacagtcttcttatggctcttgatgccagc
ctggaacatgcacttttgggctctgttatgaatgttgataggtatgcagctgcagagagc
ttttataaactagcaatggcatttgctcctgtaccagatcttcacataatgtggttactg
catctttgtgatgctcatcaggaaatgcagtcttgggctgaagctgctcagtgcgctgtt
gctgttgctggtgtagtgatgcaggcccttgtgagtagaaatgatggtgtctggagcaag
gatcatgtgagtgcattgcgcaaaatatgccccatggtcagcagtgagatcacttctgag
gcctcagcagctgaggtggagggatatggttcttcaaaactcacagttgactcggctgta
aagtatttacagcttgcaaataagcttttctctcaagctgagttattccatttctgtgca
agcattctagaacttgtaattccagtatataaaagcagaaaggcgtatggacagcttgcg
aaatgccacacaatgcttactaatatctatgaatccatccttgagcaggaatcaagccct
atacctttcacagatgccacatattatagagtaggattttacggtgagaagtttgggaag
ctggataggaaagaatatgtttatagagagcctcgtgatgtgcgattaggtgatataatg
gagaaattgagccatatctacgagtcgagaatggacggaactacattacatgtaattcct
gattctagacaagtcaaagcagatgagttgcagactggagtctgctacctgcaaataact
gcagtcgatccagttatggaggatgaagatttaggaagcagaagggaaagaatattctct
ctctctacgggaagtgtccgtgctcgagtctttgatcggtttttgtttgatacccctttt
actaaaaatggaaagacccaaggaggcttggaagatcaatggaagcggcgaacagttctg
caaactgagggatcttttccagcgctagtgaaccgactcttggttatcaaatcagaatct
cttgagttctccccggttgagaacgctattggaatgattgaaactaggacagctgcatta
aggaacgaacttgaagagcctcgaagttcagaaggcgatcaacttccccgtttgcagagc
ttacaaaggattcttcaaggttctgttgcagttcaagttaacagtggagtcctcagcgtc
tgcacagctttcctttctggtgaacctgcaactaggttacgttcgcaggagctacaacaa
cttattgctgctcttcttgaatttatggctgtgtgcaaacgtgctattcgggtacacttt
aggttgatcggggaagaagatcaggattttcatactcagcttgtaaatgggttccagtct
ctcactgcagaactatcacattatattcctgcaattctttcagagctgtag

DBGET integrated database retrieval system