KEGG   Nicotiana attenuata: 109234114Help
Entry
109234114         CDS       T05870                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
nau  Nicotiana attenuata
Pathway
nau03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nau00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109234114
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nau03041]
    109234114
Enzymes [BR:nau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109234114
Spliceosome [BR:nau03041]
 Complex C
  Other components
   Step II factors
    109234114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 T2SSE AAA_19
Motif
Other DBs
NCBI-GeneID: 109234114
NCBI-ProteinID: XP_019255506
UniProt: A0A1J6HV47
Position
11
AA seq 714 aa AA seqDB search
MPSMSANNFSRNSYHNHPNQTKGDFFARKQKIEQQRKSLPIAAVERRLVEEVRNNDTLII
VGETGSGKTTQIPQYLFKGGFCRDGGIIGITQPRRVAAITVAKRVSEECGVPLGQKVGYA
IRFEDVTSGLTKIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTIHTDVLLGLLKNVQ
KARSKCISEAVNTDHNNSNNGHASDGRIDNQNNGILKPCQAKKYNPLKLIIMSASLDARV
FSEYFGGARAVHVQGRQFPVDIFYTHKPETDCIDAALITIFQIHLEEGPGDILVFLTGQE
EIESVERLIHERLRQLPECNRKLLTFPIYSSLPSEKQMKVFMPSPAGYRKVILATNIAET
SVTIPGIKYVVDPGLVKARTYDPKMGVDSLIIVTTSKAQALQRSGRAGREGPGKCYRLYQ
ESFFEKLTDSTLPEIKRCDLSNVVLQLKALGIDDVINFDFIEKPDRTAIVNSLWSLYLLG
AVTEENKLSDVGYQMAKLPLDPVYSKALIVASQFGCLKEMLICVAMLSVESIFYAPREKL
EESRNALKSFASPDGDHLTLVNVYRAADEFFQKNNMVNSKEKAEKSLRKWCKDNYINSRS
LKHARDIHSQILRNVEQMGLRVTSCEDDMLLFCRCLAAAFFLKAAVKQPDGAYRVTLSGL
IVQIHPSSVLFRAKPECIIFNELVHTNHSYVRNVSRIDYLWLVELAPHLYALQG
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatgagtgctaataatttttcaagaaacagttatcacaatcaccctaaccaa
acaaaaggggatttttttgccaggaagcaaaagattgagcaacaaagaaaaagtttacca
attgctgcagttgaaaggagactagtggaggaggtgcgaaacaatgacactctgataatt
gttggagaaactggaagtggaaagacaactcaaatacctcagtatctttttaaaggggga
ttttgccgtgatggtggtatcattgggataactcaacctagacgtgtggctgctattact
gttgctaaacgtgtttctgaagaatgtggagttccgttgggacaaaaggttggatatgct
attagatttgaagatgtaacttctggcctgacaaagatcaaatatatgacagatggtttg
cttctaagggaagcattattggatccatacctctccaagtattctgttattattgttgat
gaggcgcacgagcgaactatacacactgatgtattgcttggcttgttaaagaatgtacag
aaagcaagatcaaagtgtattagcgaagcggtaaatactgatcataataattctaataac
gggcatgcctcggacggaaggattgacaatcagaataatggtattttgaagccatgtcaa
gcgaaaaagtataacccattgaaattgattatcatgtcagctagtctggatgcacgagtt
ttctcagagtactttggtggtgcaagagctgttcatgttcagggacggcagtttcctgtc
gatatattctatacccataagcctgagacagattgcatagatgcagctttgattactata
tttcagatacatttagaggagggtcccggtgatatacttgtattccttactggccaagaa
gagattgaatccgttgagaggcttatccatgaacgcctccggcaattacctgaatgcaat
aggaagctcttaacttttcccatatactcgtcacttccctctgagaagcaaatgaaggtt
ttcatgccttcaccagctggatatcgtaaggtgatactggcaacaaatattgctgagaca
tcggtgacaatacctggaattaagtatgttgttgatcctggactggtgaaagcacgaact
tatgatcctaagatgggagttgattcattgatcattgtcacaacgtctaaagcccaagct
ctgcaaaggagtggacgtgcaggacgtgaaggacctgggaaatgctatcgcctctatcaa
gaaagtttctttgagaaactcacagattctacattacctgagattaagagatgtgatctc
tcgaatgttgtattgcagctcaaagctctaggcattgatgatgtcattaattttgacttc
atcgaaaaaccagacaggactgcgatagtcaactcactgtggtctctctacttgttgggt
gctgtaacagaagagaataaactttcagatgttggatatcaaatggccaagctacccctt
gatccagtctattctaaggctctcattgttgctagccaattcggctgcttgaaagaaatg
ttgatctgtgttgcaatgctttcagtcgaatctattttctatgctccacgtgaaaagttg
gaagagtcacgaaatgcgttgaaaagctttgcaagtccagacggggatcatttgactttg
gttaatgtataccgcgctgctgatgagttctttcagaagaacaacatggtaaatagtaaa
gaaaaggctgaaaagagtcttagaaaatggtgcaaggataattatattaacagccgctct
ctaaaacacgcccgtgatatccacagtcaaattctgaggaatgtagagcaaatgggtctt
cgtgtcacttcttgtgaagacgatatgctcctcttctgtagatgccttgctgccgcattt
ttccttaaagcagctgtgaagcagcctgatggtgcatacagggtcacattaagtggtttg
atagtgcaaatacacccgtcttctgtcttgttccgagccaagccagagtgtataattttt
aatgaactagtccatactaatcatagttatgttcgcaatgtttctagaattgattacttg
tggctagttgagctcgctcctcacttgtatgccttgcaaggctaa

DBGET integrated database retrieval system