KEGG   Nicotiana attenuata: 109235354Help
Entry
109235354         CDS       T05870                                 

Definition
(RefSeq) bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like isoform X1
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nau  Nicotiana attenuata
Pathway
nau00740  Riboflavin metabolism
nau00790  Folate biosynthesis
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Module
nau_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    109235354
   00790 Folate biosynthesis
    109235354
Enzymes [BR:nau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     109235354
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     109235354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 SWM_repeat
Motif
Other DBs
NCBI-GeneID: 109235354
NCBI-ProteinID: XP_019256970
UniProt: A0A1J6IDT4
Position
12
AA seq 547 aa AA seqDB search
MASIQTSMGFSRLRSDHALNFVNPTTANYKSDLSSLSFARKLPFSFKSSSKILRATFISG
EDNVWSCYSNRGAENGSFVNHGAGFQQQPDAIAVGTPIAEVTPNRSGFLSGDDEFDLDHT
AEGFSSIPEAIEDIRQGKMVIVVDDEDRENEGDLIMAAQLVTPEAMAFIVKHGTGIVCVS
MKGEDLDRLQLPLMVPPKENEEKLSTAFTVSVDAKYGTTTGVSARDRAKTVLTLASKDSK
PEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAVLAGLDPVAVLCEIVDDDGSMARLPR
LQQFAEAENLKIISIADLIRYRRKREKLVELAAAAPIPTMWGPFKAYCFKSVLDGIEHIA
MVKGDIGDGKDVLVRVHSECLTGDIFGSARCDCGKQLALAMKQIEQAGRGVLVYLRGHEG
RGIGLGHKLRAYNLQDDGHDTVEANEELGLPVDSREYGIGAQILRDLGVRTMKLMTNNPA
KYVGLKGYGLAIAGRVPLLAPITTENRRYLETKRVKLGHVYGSDANGHINGSEVGRASSD
ELSDNAA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattcaaacttcaatgggtttttcccgtctgcgatccgaccatgctctgaat
tttgtcaatccaactacagcaaactacaaatcagatttgtcctcgctaagttttgctaga
aagttgcccttcagcttcaaaagtagcagcaaaatactaagggctacatttatatcagga
gaagacaatgtttggtcttgttatagcaaccgaggtgcagaaaatggttcttttgttaat
cacggagctggatttcagcaacaacctgatgcaatagctgttggaacacctattgccgaa
gtaactccaaacagaagtgggtttctctctggtgatgatgaatttgacctcgaccatacc
gctgaaggattctcttctattccggaggctattgaagacattcgtcaaggcaagatggtg
attgtcgtagatgatgaagacagagaaaatgagggtgatctgataatggcagcacaatta
gtgacccctgaagcaatggcgttcattgtaaaacatggaactggaattgtgtgtgtaagt
atgaaaggtgaagatctagacaggcttcaacttccactaatggtgccaccgaaagaaaat
gaggagaaactctctactgctttcactgtttctgtggatgcaaaatatggtaccacaaca
ggtgtatcggctcgtgatagggcaaaaactgtattaactctggcatccaaagattcaaaa
cctgaggatttcaaccgacctggacatattttcccactcaagtatagagaaggaggggtg
cttaaaagagctggccatactgaagcttctgttgatcttgctgtattggctgggttggac
cctgttgctgttctttgtgaaatagtggatgatgatggttccatggccaggttgccgagg
cttcagcagttcgctgaggctgagaacctaaagattatatccattgccgatttgatcagg
tatagaaggaagagagagaaactggtggagctagctgccgctgcaccaataccaacaatg
tggggaccttttaaagcctactgttttaagtctgtcttggatggtattgagcatattgcc
atggtcaaaggtgatatcggggatgggaaagatgtccttgtcagagtgcactcagaatgt
ctcaccggcgacatatttgggtcagcgagatgtgactgtggtaagcagttggcacttgca
atgaagcaaattgagcaagctggaagaggtgtgttggtatacctccgtggacatgaagga
cggggaataggtttgggacataaacttcgcgcttacaacctgcaagatgatgggcacgac
acggttgaagctaatgaagagttgggattacctgttgattctcgggagtatggcattggt
gcacagatacttcgagatttaggtgttcgtacaatgaaactgatgacaaacaaccctgca
aagtatgttgggctcaaaggatatggtctggcaattgcaggtagagttccgctattggcg
cctataactacagaaaatagaagatacttagagaccaaacgtgtgaaactggggcacgta
tatggttccgatgccaatggccacattaatggttctgaagttgggagagcgagcagcgat
gaattatctgacaatgctgcctaa

DBGET integrated database retrieval system