KEGG   Nicotiana attenuata: 109235514Help
Entry
109235514         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein LOC109235514
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
nau  Nicotiana attenuata
Pathway
nau00900  Terpenoid backbone biosynthesis
nau00909  Sesquiterpenoid and triterpenoid biosynthesis
nau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109235514
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109235514
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     109235514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 adh_short RmlD_sub_bind KR
Motif
Other DBs
NCBI-GeneID: 109235514
NCBI-ProteinID: XP_019257204
UniProt: A0A1J6HT96
Position
12
AA seq 328 aa AA seqDB search
MNKTVILVTGASGYLGGRLCHQLFNAGHHVKAFVRHTSNLSSLPPPTDGGSGGGTLELVF
GDVTDYQSLRQACSGCHVIFHAAAVVELWFPDPSRLFSVNVGGLKNVLQAYKETGTIEKI
VYTSSFFALGSTDGYVADETQTHTGKFFCKEYEKSKAVADKVALDAASEGIPIVPVYPGL
IYGPGKVTDANIVARMIIERFSGRLPGYFGQANERFSFSHVDDVVEGHIAAMEKGKPGER
YLLTGENASFKQVCDIAAMITQTRRPSFGIPLLIIEAYGWISVLFSKLTGNLPLISPTIV
SAVRHQWAYSCEKAKAELDYNPRSLKEG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacggtgatattggtaaccggagcttctggttacctgggtggacggctctgc
caccagctattcaacgctggccaccatgttaaggctttcgttcgccatacaagcaaccta
tcttctctacctccgcctactgatggcggaagcggcggcggaaccttagagcttgtgttt
ggagatgttacagattatcagtcactccgtcaagcctgctccggttgccacgtcatcttt
catgctgctgcagtggtcgagctatggtttcctgatccatctagattattctcagtcaat
gttggagggttgaagaatgtgttacaagcttataaagaaacgggaactatagagaaaatt
gtgtacacatcgtcgttttttgccttgggatcaactgatggatatgttgccgatgaaact
cagactcatactggaaagttcttctgtaaggagtacgagaaatcgaaagctgttgctgat
aaagttgcattagatgctgcgtctgaaggaattccgatagtgcctgtttatccaggactc
atatatggtcctggaaaggtcacggatgcaaatatcgttgcacgtatgataattgagcgc
tttagtgggcgtttacctggttattttgggcaagcaaatgaaaggttctcttttagtcat
gttgatgatgtggttgaggggcatattgcagctatggagaaaggcaaaccaggtgaaagg
tatcttcttactggggagaatgcgtcatttaagcaagtttgcgacatagctgccatgatt
actcagacaagaaggccttcatttggaatccccctacttattattgaagcctacggctgg
atatcagttcttttctccaaattaacaggaaaccttcctctaatcagtcctacgattgtt
tccgcggttagacatcagtgggcttactcttgtgagaaggcaaaagcagagttggattac
aaccccagaagcttgaaagaaggttag

DBGET integrated database retrieval system