KEGG   Nicotiana attenuata: 109238950Help
Entry
109238950         CDS       T05870                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109238950
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     109238950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 109238950
NCBI-ProteinID: XP_019260992
UniProt: A0A314LCC2
Position
Unknown
AA seq 686 aa AA seqDB search
MESSSELVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPK
SLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA
DDDLYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN
RQYEHFNKIGKVIDEQLSEQGAKRIVPVGLGDDDQCIEDDFAAWREQLWPELDQILRDED
DANSAAIPYTAAIPEYRLVIHDTAASHDDKHASMANGNTSYDIHHPCKVNVAVQRELHTP
ESDRSCIHLEFDISGTGISYETGDHVGVYAENPEEIVEEAARLLGQSLDLIFSIHTDKED
GTALGGSLPPPFPGPCTLRAALARFADLLNPPRKATLVALAAHAAEPSEAEKLKFLASPL
GKDEYSAWVVASQRSLLEVMAEFPSAKPPLGVFFAAVAPRLQPRYYSISSSPRFAPARIH
VTCALVYGPTPTGRIHKGVCSTWMKNAVPLEKSQNCSSAPIFIRPSNFKLPVDPSVPIVM
VGPGTGLAPFRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQDVISE
LIIAFSREGPQKEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHIIVQEQ
DKVDSTKAEAIVKKLQMDGRYLRDVW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagttcggagttggtgagatcgattgaatcggcgttaggagtgtcgttgggg
agcgatacggtgttggtgctactgacgacgtcgtttgctgtcatcgttgggttagtggtg
ttgtttttgaagagatcaagtgatcggagtaaagaagttaagcctatcgtgttccccaag
tccttacatgtggagccggaggaggagattgagctggaacctggaaaagttaaggtcacc
gtatttttcggtactcaaactggtactgctgagggttttgccaaggctttatcggaggag
ataaaagcaagatatgagaaggcagtagtaaaagttgtggacatggatgattatgctgcc
gatgatgatctgtatgaggagaaactgaagaaagaaacagtagcatttttcatggtggca
acctatggggatggcgagcccactgataatgctgcaaggttttacaagtggttcactgag
ggacaagaacggggcacgtggctgcagcaccttacgtatggcgtttttggcttgggtaat
cgccaatatgaacattttaacaagattgggaaggtgatagatgaacaattaagtgaacaa
ggtgcaaaacgtattgtgcctgttggccttggtgatgatgatcagtgcattgaagatgat
tttgctgcctggcgagaacaactgtggcctgaattagatcaaatacttagagatgaggat
gatgcaaattctgcagccattccatatacagctgcaattcctgaatatcgtttggttatc
catgataccgctgcgagtcatgatgataagcatgccagcatggctaatggaaatacctcg
tatgacatccatcatccatgcaaagtaaatgttgctgttcaaagggagcttcacacaccc
gaatctgatcgctcatgtatacacttggagtttgatatatctggcactgggatttcctat
gaaacaggagatcatgtgggtgtttatgctgaaaatcctgaagaaattgttgaggaagct
gcgagattgctcgggcagtcattagacttaatattctctattcatactgacaaggaggac
ggtacagctcttggaggctcgttgcccccacctttccctggtccttgcacactgcgagct
gcacttgcacgtttcgcagatcttctgaatcctccgcggaaggctactttggttgcattg
gctgcccatgcagctgaacctagtgaagcagaaaagctcaagttcttggcatctccactg
ggcaaggatgagtattctgcatgggttgttgcaagtcaaagaagtcttcttgaagtaatg
gctgagttcccttcggcaaagcctccccttggtgtattttttgcagcggttgcccctcgt
ttacagcctcgttactattcaatctcgtcatctcctcgatttgctcctgctagaatccat
gtgacctgtgcactagtctatggtccaactcccactggccgaattcacaaaggagtgtgt
tcgacttggatgaagaatgcagttccattggagaaaagtcaaaattgcagctctgctcca
atcttcattaggccatctaatttcaagttaccggttgacccttcagttccaattgtcatg
gtgggacctggtactggtttggcaccatttaggggattcctgcaggaaagagcagcattg
aaggaagatggggctcaacttggtcctgctttgttgttttttggttgtaggaatcgtaga
atggattttatttatgaggaggagcttcagagttttgtggatcaagatgtaatatcagag
ctgattattgcattttcaagggaaggaccccagaaagagtatgttcaacataaaatgctg
gaaaaggcttcccatgtttggagtttaatctcccaggagggatatctatatgtatgtggg
gatgcgaaagggatggccagggatgtacatcgtacactccatatcatagtccaggagcag
gataaggtcgactcaaccaaagctgaggctattgtgaagaaactccaaatggatggaaga
tatctcagggatgtatggtga

DBGET integrated database retrieval system