KEGG   Nicotiana attenuata: 109240806Help
Entry
109240806         CDS       T05870                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nau  Nicotiana attenuata
Pathway
nau00520  Amino sugar and nucleotide sugar metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109240806
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     109240806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind KR
Motif
Other DBs
NCBI-GeneID: 109240806
NCBI-ProteinID: XP_019263035
UniProt: A0A314L796
Position
Unknown
AA seq 346 aa AA seqDB search
MAKNSANGDHQTTTKPPPTPSPLRFSKFFQPNMRILVTGGAGFIGSHLVDKLMENEKNEV
IVVDNFFTGSKDNLKKWIGHPRFELKRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKT
IKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQTEEYWGNVNPIGVRSCYDEGK
RVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRDEPLTVQAPGTQ
TRSFCYVSDMVNGLIRLMEGENTGPINIGNPGEFTMIELAELVKELINPKVEIKSVENTP
DDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKKI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaattctgcaaatggagatcaccaaacaacaacaaagcctcctccaactcca
tctccgttgcgcttctcaaagttctttcagcctaacatgagaattttggttaccggagga
gctggatttattggttcccacctagttgacaaattgatggagaatgagaagaatgaggtt
attgttgtggacaactttttcactggttcgaaggataatcttaaaaaatggattggtcat
cccagatttgagcttaagcgccatgatgtgaccgagcccttgttagttgaggttgatcag
atttatcatctggcatgccctgcttctccaatattctacaagtacaatcctgttaagaca
ataaagactaatgtcattggcacgctaaatatgttgggcttagcaaagcgtgttggagca
aggattctgctaacgtcaacctcagaggtttatggtgaccctcttgtgcatcctcaaact
gaggaatattggggtaatgttaacccaattggggttcggagctgttatgatgaggggaag
cgtgtggcagagacattgatgtttgactaccaccgacagcatgggattgaaattcgcatt
gctagaatattcaatacatatggacctcggatgaatattgatgatgggcgtgttgtcagc
aactttatagctcaagcacttcgtgatgaaccattaaccgttcaagctcctgggacacag
actcgcagtttctgttatgtttctgatatggttaatgggcttattcggctaatggaaggg
gaaaacacagggccaatcaacattggaaatccaggtgaatttaccatgattgagcttgca
gaactagtgaaggagcttatcaatccgaaagtggagatcaaatcagttgaaaatacacca
gatgatccaagacaaaggaaaccagatatcacaaaagcaaaagaattgttaggatgggaa
ccaaaagtcaagttgcgcgatggccttccactaatggaagaagatttcagactgaggctt
ggggtctctaagaagatataa

DBGET integrated database retrieval system