KEGG   Nicotiana attenuata: 109241106Help
Entry
109241106         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein LOC109241106 isoform X1
  KO
K06195  ApaG protein
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    109241106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 109241106
NCBI-ProteinID: XP_019263370
UniProt: A0A314L7V6
Position
Unknown
AA seq 282 aa AA seqDB search
MQSLSFNLNAGTKVSWPGRFNQGDGSKQQIHIRGNVKMFRIMACAPEMNSGAESQSSSPS
PSESSFLSRSQTYALLKQQMEVATKSEDYKQAARLRDSLKIFEDEEPVLRLRRLLKEAIA
EERFEDAARYRDELKDVAPHSLLKCSSDATTLGIRVQVRSVYIEGRSHPSKGLYFFAYRI
RITNNSDRPVQLLRRHWIITDANGKTENVWGIGVIGEQPVILPNTGFEYSSACPLGTPSG
RMEGDFEMKHIDKVGSRTFNVAIAPFSLSKVGDGSDTFSDGS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcacttagttttaatcttaatgccggaacgaaagtgtcatggcctggtcgattt
aaccagggagatggaagtaagcaacaaattcacatcagaggaaatgtgaagatgtttaga
atcatggcgtgtgcgcctgagatgaatagtggtgcagagagccagagttctagtcccagt
ccaagtgagagttccttcctttcccgtagccagacctatgcacttttgaaacagcaaatg
gaagtcgccaccaaatctgaggactacaagcaggcggcgagacttcgtgattcattgaaa
atatttgaggatgaagaacctgttttgcggcttaggagattgttgaaagaggctattgca
gaagagaggtttgaggatgcagcgaggtaccgtgatgagttaaaggatgtggctccacat
tctctcttgaaatgttcgagtgacgcaacaacactgggtatcagggttcaagttagaagc
gtgtatatagaaggtcgaagtcatccttcaaaaggcctttatttttttgcttatagaata
agaattaccaacaactcagatcgtcctgttcagcttctgagaaggcactggatcatcact
gatgctaatggaaaaacagaaaatgtctgggggattggtgtcattggtgaacaaccggta
atacttcccaacactggttttgaatactcgtctgcatgcccattaggaactccaagtgga
agaatggagggtgacttcgagatgaagcacattgataaggtaggctcacggacattcaat
gttgccattgctcctttctctctatccaaagttggagatggaagtgataccttttcagat
gggagctga

DBGET integrated database retrieval system