KEGG   Nicotiana attenuata: 109241923Help
Entry
109241923         CDS       T05870                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109241923
   01009 Protein phosphatases and associated proteins [BR:nau01009]
    109241923
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109241923
Protein kinases [BR:nau01001]
 Serine/threonine kinases: Other
  Wnk family
   109241923
Protein phosphatases and associated proteins [BR:nau01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109241923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 109241923
NCBI-ProteinID: XP_019264296
Position
Unknown
AA seq 307 aa AA seqDB search
MVQSVSVDPSDRDSEPFVEVDPTGRYGRYDELLGYGAVKKVYRAFDQEEGIEVAWNQVKL
RNFMDDQPVIDRLYSEVRLLKTLKHKNIIALYSVWRDENRNTLNFITEVCTSGNLREYRN
KHKHVSMKAVKKWSKQILKGLDYLHTHEPCVIHRDLNCSNVFINGNVGQVKIGDLGFATI
VGKSHSAHSVLGTPEFMAPELYDEDYTELIDIYSFGMCVLEMVTLDLPYSECDNVVKIYK
KVISGVRPKAMDKVKDPEAKDFIEKCLAQPRVRPSASELLQDPFFEGIDDDENDDEEYTA
ANKYWPA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagagcgtgagcgtggatccatcggatcgggactcggagccgtttgtggaggtg
gaccccacaggaagatacgggcgatacgacgagcttttaggctatggagcggtgaaaaaa
gtgtacagagcgtttgatcaagaagaagggattgaagtagcatggaaccaagtcaaatta
cgcaatttcatggatgatcagccggtgattgaccggttatactcggaagtccggctattg
aaaaccttaaagcataaaaacataatcgcattgtactctgtttggagggacgaaaatcgc
aacactttgaatttcataacggaggtttgtacgtcagggaatttgagggagtataggaat
aaacacaaacatgtgtcgatgaaggcggtaaagaagtggtccaagcagattctcaagggg
ttggactatttgcatacacatgaaccttgtgttattcacagggatctcaattgcagtaac
gtcttcattaatggcaatgttggacaggttaagattggtgatttgggctttgcaacaata
gtagggaagagtcattcagcacattcagtgcttgggaccccggaattcatggcaccagag
ctatacgacgaggattatacagagttgatcgatatctactcgtttggaatgtgtgttttg
gagatggtgactctggatttaccctacagtgagtgtgacaatgtagtcaagatatacaag
aaggtaatatctggagtgaggcctaaggcaatggacaaggttaaagaccctgaggccaag
gacttcattgagaagtgtcttgctcaacccagggttaggccttctgcttctgaactcctt
caagaccccttctttgaaggtattgatgatgacgaaaacgacgacgaagaatatactgct
gctaacaaatattggcctgcctag

DBGET integrated database retrieval system