KEGG   Nicotiana attenuata: 109243824Help
Entry
109243824         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein LOC109243824
  KO
K02890  large subunit ribosomal protein L22
Organism
nau  Nicotiana attenuata
Pathway
nau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109243824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nau03011]
    109243824
Ribosome [BR:nau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    109243824
  Bacteria
    109243824
  Archaea
    109243824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 109243824
NCBI-ProteinID: XP_019266367
UniProt: A0A314L0B1
Position
Unknown
AA seq 273 aa AA seqDB search
MVGWQRHLQRMLHQAGKRYHQSRTIPFNSHYHSKSSLVLGEAPYLPRLQNTVSSGISRPL
YQYLQHLGLSSTRTLLADASDATPISSPLIPLLTSNTGNKEAEKATSKPSTVQAILKGIK
QSPKKINLVAALVRGMRVEDALLQLQVTVKRASKTVYQVIHSARANATHNYGFDPDRLLV
AEAFVGKGLFKKRVSYHAKGKCGIKVRPECRLTVVVREITPEEEVEIAKLRVHNFKKLTK
RERRLVPHKLIETTPIWDRKGRAKSNRPGAAAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggtaggctggcaacgacatcttcagcgcatgctccatcaagctgggaagagatatcac
caaagtcgaactattcctttcaattcacattatcactcaaagtcgtctctagtgcttggt
gaggcaccttacttgccaagattgcagaatacggtttcatctggcatctcaaggccatta
taccagtatctacagcatttggggctctctagtacaaggaccttacttgcagacgcatct
gatgctacaccaatttcttccccattgataccgcttctaacatcaaatactggaaataaa
gaagctgagaaagcaacttctaaaccttcaacagttcaagcaattttgaaggggataaaa
cagagcccaaagaagattaatttggttgctgcattagttcgtgggatgcgtgttgaagat
gcattgttgcagttgcaagtgactgtaaaacgagcttccaaaactgtctatcaggttata
cattcagctcgggcaaatgcaacccacaattatggatttgatccagatcgtcttcttgtt
gctgaggcttttgttgggaaaggacttttcaaaaaaagggtgtcctaccatgctaaagga
aagtgtggaataaaagtgaggccagaatgtagactgaccgttgtagttagggagataact
cctgaggaggaggtcgagatagctaagttgagagtacacaacttcaagaagctcaccaaa
cgcgaaaggcgtctagttcctcataagctcattgagactactccaatatgggaccgcaaa
ggcagagctaagagcaatagaccaggtgctgctgctgcttga

DBGET integrated database retrieval system