KEGG   Nicotiana attenuata: 109244890Help
Entry
109244890         CDS       T05870                                 

Definition
(RefSeq) uncharacterized protein LOC109244890
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nau  Nicotiana attenuata
Pathway
nau00790  Folate biosynthesis
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109244890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nau04147]
    109244890
Enzymes [BR:nau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     109244890
Exosome [BR:nau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109244890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 109244890
NCBI-ProteinID: XP_019267595
UniProt: A0A314KZ29
Position
Unknown
AA seq 211 aa AA seqDB search
MATATHFCFPPPISVSAQKIQNAKFFTPSLQTTQSQICTRIRCNGGDLLGDFGARDPFPA
EIESKFGEKVLGNTDTEHKILIPTASALSLAQQECTVISPGQTPLSEYEARQLLFKVVGW
RLAHEGGVLKLQCTWKLRDFECGVELINRIGKVVEGTGHVPTLLHLEQSNQVRAELWTAS
IGGLSINDFIVAAKIDQIKTSDLVPRKRVWA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcaactcatttttgtttccctccaccaatttcagtctctgctcagaaaatt
caaaacgctaaattttttacccccagtctccagactacccaatctcaaatttgcaccaga
attcgttgcaatgggggagacctattgggcgattttggggcgagagatccgttcccagct
gaaatagagagtaaatttggtgaaaaagttttgggtaatactgatacggagcacaaaatt
ctcatcccaactgcttctgctctgtcccttgctcagcaagagtgcactgttatctcgcct
ggtcaaactcctctctcggagtatgaagctcgccagctcctattcaaggttgttggatgg
agactggcacatgaaggtggggtgctcaagctacaatgtacgtggaaattaagagacttc
gaatgtggggttgaacttatcaatagaataggcaaggtggtggaaggcactgggcacgtc
cccacacttcttcacttagagcagtccaatcaagttcgtgctgagctatggactgcttcc
atcggaggtttgagcataaacgatttcattgtagctgctaaaatagatcagataaagaca
tcggaccttgtcccaagaaaaagagtttgggcataa

DBGET integrated database retrieval system