KEGG   'Nostoc azollae' 0708: Aazo_0182Help
Entry
Aazo_0182         CDS       T01260                                 

Definition
(GenBank) oxidoreductase domain protein
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00860  Porphyrin and chlorophyll metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aazo_0182
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Aazo_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 Shikimate_DH OCD_Mu_crystall F420_oxidored Semialdhyde_dh NAD_binding_7 DHHA2 Biliv-reduc_cat Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ADI62810
UniProt: D7DYI7
Position
175171..176178
Genome map
AA seq 335 aa AA seqDB search
MYNSNAPLANTTMRVGLVGTGSAAKLRAEALRQDTRAHLVAISGHTSEKTAALAQEYQTE
VMNSWQKLVARKDLDLVIISTVNRDHGQITRAALTSGKHVIVEYPLSVDIKEAEELIALA
KAKNKLLHVEHIELLGGWHQALKQYLLQLGQLFYIRYSTVKPEHPAPRKWTYNHELFGFP
FIGALSRLHRLTNLFGKVLTVNCHQRYWETQSDYYQSCLCVVQLYFATGLLAQVIYGKGE
SLWQSERKMEINGEKGGLILDGDTGILVQPEETKLIEVSGRRGLFVKDTTMVLDHLLYGT
SLYVTPEQSLYALKVADAARRAAETGLTIFLTKES
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtataattccaatgcacctttggcaaatacaactatgcgggtgggtttagttggtact
gggtctgcggcaaaactccgggctgaggcattgcggcaagatacacgcgcacatttagta
gcaatttctggacatacttccgaaaaaacagcagctttggctcaagaatatcaaactgag
gtgatgaattcttggcaaaagttggtggcacgaaaagatttagatttagttatcatatcc
acggttaatcgagatcatggtcaaattacccgtgcagcccttactagtggcaagcacgtt
attgttgagtatcccttgtctgtagatattaaagaggctgaagaattaattgctttagcc
aaagccaaaaataaactgctgcacgtcgaacatattgaacttttgggcggttggcatcaa
gccttaaaacaatatttactccaacttggtcagttgttttatatccgctacagcacagtc
aaacctgaacatccagcaccaaggaaatggacttataaccatgagcttttcggctttcct
ttcattggcgctctttctcgcttacatcggctcacaaatttgtttggcaaagttttaacg
gtgaattgtcaccagcgatattgggaaacacagtcagattattaccaaagctgtttatgc
gtcgttcaattgtactttgccactgggttgttagcccaagttatttatggtaaaggtgaa
tccctttggcagtcagaacggaaaatggaaattaatggtgaaaaagggggattaattctg
gatggtgacacaggaattttggttcagccagaggaaacaaagttgattgaggtgagtggt
cgtcgcggattatttgtcaaagatacaacaatggtattagaccatcttttgtatggtact
tctttgtatgtcactccagagcaaagcttgtatgccctaaaggtcgcagatgctgcacgt
agggctgcggaaacaggtttaactatttttttaacaaaagagtcctaa

DBGET integrated database retrieval system