KEGG   'Nostoc azollae' 0708: Aazo_0586Help
Entry
Aazo_0586         CDS       T01260                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00521  Streptomycin biosynthesis
naz00523  Polyketide sugar unit biosynthesis
naz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Aazo_0586
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aazo_0586
Enzymes [BR:naz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Aazo_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADI63080
UniProt: D7E0V1
Position
complement(613910..614242)
Genome map
AA seq 110 aa AA seqDB search
MNVVFTEISDVLLIEPQILGDKRGFFYESYNERVFLEKVGILSHFVQDNHSRSIKDVLRG
LHYQIEKPQGKLVRVVVGSVFDVAVDLRKISATFGQSVGVCLSAENKDQL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgtgtttacagaaatatctgatgtgctgctaattgagccccaaatccttgga
gataaacgtggctttttttatgaaagttataacgaaagagtttttttagaaaaggtagga
atattatctcattttgtccaagataatcactcacgttctattaaagatgttttgcgtggt
ttgcactaccaaattgagaagccccaaggaaaactggtgagagttgtagtaggttcggta
tttgatgtggctgttgatttgcgaaaaatttctgccacttttggtcaatctgttggtgtg
tgtttgtcggctgaaaataaagatcaattgtga

DBGET integrated database retrieval system