KEGG   'Nostoc azollae' 0708: Aazo_1439Help
Entry
Aazo_1439         CDS       T01260                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00020  Citrate cycle (TCA cycle)
naz00620  Pyruvate metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
Module
naz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_1439
   00020 Citrate cycle (TCA cycle)
    Aazo_1439
   00620 Pyruvate metabolism
    Aazo_1439
Enzymes [BR:naz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aazo_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: ADI63666
UniProt: D7E3Z8
Position
complement(1508677..1510035)
Genome map
AA seq 452 aa AA seqDB search
MIWQQLVKFHKIIDSETTIMSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVE
SDKADMDVESFYEGFLAHIIVQAGETAPIGAAIAYVAQTEAEIEAAKTMAGGGSAVAQTH
TPIPAAPTVATTATPSQNGSNHREERLVVSPRARKLAKELQVDLNNLKGSGPYGRIVAED
VEAAVGKVQPPTTRAVTPTQPTPPVIPAPPPAPAKPAAVTAPVVSSAVPGQVVPLTTLQN
TVVRNMVTSLSVPIFHVGYTITTAALDKLYKQIKSKGVTMTALLAKAVAVTLEKHPLLNA
SYSDQGIVYHPNINISVAVAMDDGGLITPVMQKANQVDIYSLSRNWKSLVDRARAKQLQP
EEYNSGTFTLSNLGMFGVDTFDAILPPGQGSILAIAASRPQVVATADGLFGVRKQMKVNI
TCDHRIIYGAHAATFLQDLAKLIETNPQSLIL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttgatctggcaacaacttgttaaattccataaaattattgattctgaaaccaccattatg
agcattcatgaagtatttatgcccgcgctgagttccaccatgacagaggggaagattgtc
tcttgggtaaaatcgccaggggataaagtggaaaaaggcgaaacagtggtggttgttgag
tcggataaggctgatatggatgtggaatctttctatgagggatttctagcccatattata
gtacaagctggtgaaacagccccaattggcgcagcgatcgcttacgtagcacaaacagaa
gcggaaattgaagctgctaagactatggctggtggaggtagtgcagtggctcaaacacac
acacccatacccgcagccccaaccgtagccacaactgctacaccctctcaaaatggttct
aaccatcgggaagaacggttagtagtgtcaccccgcgctcgcaagttagcaaaagaactc
caggttgatttaaataaccttaaaggtagtggtccttatggtcgcattgtggccgaagat
gtggaagctgcagttggcaaagttcagccacccactacccgtgctgtcaccccaactcaa
ccgacaccacctgttattccggccccacccccagcacctgcaaaaccagccgctgtaact
gcaccagttgttagcagtgctgttcctggtcaagtagtaccattaactactctgcaaaat
acagtggtacgtaatatggtgacaagtctatctgtacctatattccatgttggttacaca
attaccactgctgcattagataaactttacaagcaaattaaatctaaaggtgtgacaatg
acggcgctattggccaaagctgtagcggtgacattggaaaaacatccattactcaatgcc
agctattcagaccaaggaattgtctatcatcccaatatcaatatttccgtagctgtggcg
atggatgatggtggtttgattacaccagtaatgcagaaagcaaatcaagtagatatctat
tctctatctcgcaattggaaatctttggtagatagggctagagcaaaacaactacaacca
gaagagtataacagtggtacttttaccctttctaacctgggtatgtttggtgtagataca
tttgatgcgattttaccacctggacaaggttcaattttagcgatcgccgcatcgcgtccg
caagttgtagctaccgcagatggtttatttggtgtacgtaaacaaatgaaagttaatatc
acctgtgatcaccgcattatttacggcgctcatgcagcaacattcttgcaagatttagcg
aagttgattgaaaccaatcctcaatctttaatactttaa

DBGET integrated database retrieval system