KEGG   'Nostoc azollae' 0708: Aazo_1904Help
Entry
Aazo_1904         CDS       T01260                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00270  Cysteine and methionine metabolism
naz00480  Glutathione metabolism
naz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Aazo_1904
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Aazo_1904
Enzymes [BR:naz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Aazo_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ADI63996
UniProt: D7DVY7
Position
complement(1976555..1977517)
Genome map
AA seq 320 aa AA seqDB search
MKLAFIIDPIHQLDPGHDTSVALMEAAQKLGHGVWVTQTNLLSVVKGKAWALLQQVELVP
VEVVEGRWLAANPWYNLRECSFTLLETMDAVFMRTDPPVNDAYLYATYTLDYIDQNKTLV
INNPSGIRAANEKMYALQFSQCIPETIVSADKQVIRQFVEAKGSTVLKPLGNKAGEGILF
LQSGDRNFNSIVELSTLQGRLPVMVQNYLPEAKEGDKRIILLNGKPIGALNRLSSGSDFR
NNMAAGGTVAQTEITPREQEICGLLADKLSQDGLIFVGIDVIGGYLTEVNVTSPTGIREI
DRLDGTCLGHQVIQWLEKKV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggcttttattattgatcccatccatcagcttgaccctggtcatgataccagt
gttgctcttatggaagctgcacaaaagttaggacatggagtttgggttacacagacaaac
ctgttgagtgtggtgaaaggaaaagcttgggctttgcttcagcaggtggaacttgtacca
gtggaggtggtggaggggcgttggttagcagcgaatccttggtataacttgagggaatgt
tcttttactctcttagaaacaatggatgctgtgtttatgcggacagatccaccagttaat
gatgcttatttatatgcaacttatactctggattatattgaccaaaataaaaccttggtg
attaacaatcccagtggtatcagagccgcaaatgaaaaaatgtatgctctccaatttagc
caatgtattcccgaaacaattgtcagtgctgataaacaggtgatccgccaatttgtagag
gccaagggttcaacggttcttaaaccactggggaataaagctggggaggggattttattt
ttgcaatcaggtgatcgcaattttaactctattgtcgaactgagtacccttcaaggtcga
ttaccagtaatggtacagaactatctaccagaagcgaaagagggagacaagcggattatt
ttgctcaatggtaaacccataggggcactcaatcgtctctccagtggcagcgattttcgt
aataatatggcagctggcggcactgtggcacaaacggaaattacaccaagagagcaggaa
atttgcggcttattagccgacaaactgagtcaagacggtttaattttcgttggcattgat
gtcattggtggataccttacagaagtcaatgtcaccagtcctacagggattcgggaaatt
gatcgtctggatggaacttgccttggtcatcaggttattcaatggttagaaaagaaggta
tag

DBGET integrated database retrieval system