KEGG   'Nostoc azollae' 0708: Aazo_2496Help
Entry
Aazo_2496         CDS       T01260                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00770  Pantothenate and CoA biosynthesis
naz01100  Metabolic pathways
Module
naz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Aazo_2496
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Aazo_2496
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Aazo_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADI64397
UniProt: D7DYR8
Position
complement(2602573..2603814)
Genome map
AA seq 413 aa AA seqDB search
MQSSANPKSQIPNPQSRRVIVAIGGGIAAYKVCELVSTLFKSGVEVRVILTKSAQEFVTP
LTLATLSRHQAYTDDYFCQPIYFRPLHIELGEWADLIVIAPLTANTLAKLAYGMADNLLT
NTVLASTCPVLLAPAMNTDMWEQVAVQRNWRQLLTDKRFHGIETGSGLLACDRIGAGRMA
EPAEICVYIQSLLHTQGKRDLAGKQILISAGGTQEYLDPVRFIGNPSTGKMGLGLAQAAL
HRGAKVILVHCPASWDVPLGVEGIEVVSADQMQHVMLERLANADITVMSAAVADIKPQEY
STEKLPKRSLPENLPLAPVPDIVAELGKRKQPHQSLIGFAAQTGDIITPAREKLQRKQLD
AIVANPIDKTDSGFGSDNNQAVFLDKQGREVEIPACSKLEMAHYLFDFLVGNW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatctgcaaatcccaaatcccaaatcccaaatcctcaatccagacgagttatt
gttgctataggcggcggtatcgccgcctataaagtctgtgaattagtttctactctgttt
aagtctggggtagaagtgcgagttattcttactaagtctgctcaagaatttgtcactcct
ttaactttagccactttatcccggcatcaagcttatactgatgattatttttgccaacca
atttattttcgtcccttgcatattgagttgggtgaatgggccgatttaatcgtaattgcg
cctttaactgctaatactttggctaaattagcttatggaatggcagataatttactgaca
aatactgttctcgcttctacttgtcccgtgttgttagcaccagccatgaatacagatatg
tgggaacaggtagcggtgcaaagaaattggcggcagctgttgacagataagaggtttcat
ggtattgaaactggttctggtttgctggcgtgcgatcgcattggtgctggcagaatggca
gaacccgcagaaatatgtgtttatattcaatctttattacatacccaagggaaaagagat
ttagctggcaagcagattttaatcagtgctggaggaacgcaagaatatttagatccggtg
cgatttattggcaatccctccacaggtaaaatgggtttaggattagcacaggcagcactg
cacagaggtgcaaaagtaatattagtgcattgtccagcgagttgggatgtacctttggga
gtggaaggaattgaggtagttagtgcagaccaaatgcagcacgtaatgttagagcgttta
gctaatgcagatataactgtcatgtctgccgcagttgcagatatcaagcctcaagaatat
agtaccgaaaaattacccaagcgatcactccccgaaaatttacctcttgcaccagtaccg
gatatagttgctgaattaggaaaacgcaaacaaccccatcaatcattaattggttttgca
gcacaaacaggcgatattattactcctgcgcgggaaaaattgcagagaaaacaattagat
gcaattgtagcgaatcctattgataagactgatagtggttttggtagtgataataatcaa
gcggtgtttttagataagcaaggaagagaggtagaaattccggcttgttctaagttggaa
atggcgcattatttatttgattttcttgttggtaattggtga

DBGET integrated database retrieval system