KEGG   'Nostoc azollae' 0708: Aazo_3280Help
Entry
Aazo_3280         CDS       T01260                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00860  Porphyrin and chlorophyll metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aazo_3280
Enzymes [BR:naz01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Aazo_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA AAA_18 DUF815 ABC_tran tRNA_lig_kinase AAA_30 MMR_HSR1 AAA_28 RNA_helicase AAA_27
Motif
Other DBs
NCBI-ProteinID: ADI64965
UniProt: D7E2E3
Position
3363642..3364763
Genome map
AA seq 373 aa AA seqDB search
MTPTAQSMASARRVIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEISVVANDPFSSDPSDPDLMSDEVRQLVSQGAEIPIAHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVHIVEKRSEFDQNP
PFFLENYKSEQEGLQEKIVKAQELLPQVNLDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTAFEGRTQVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVQKAFARVFGVELSEDDA
AQKNGTGIKGGAR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaactgctcaatctatggcaagtgcgcgtcgcgtgatctttccgtttactgca
attgtcggccaggaagaaatgaaactggcgttgctgttaaacgttattgaccccaaaatt
ggtggtgtaatgattatgggcgatcgcggcaccggcaaatccacaactatccgcgctttg
gcagacctgctgccagaaatctccgtggttgccaatgaccccttcagcagtgaccccagc
gacccggacttgatgagcgatgaagtccgtcaactagtatcccaaggggcagaaattccc
atagctcacaaaaaagtacagatggtagatttaccattgggagctacagaagaccgggtt
tgtggtaccatcgacatcgaaaaagctttgtctgaaggtgtaaaagcttttgaaccagga
ctactggccaaagcgaatcggggtattctctacgtcgatgaagtcaacttgttagatgac
cacttggtagacgtacttctggactctgctgctagtggttggaacacggtagaacgggaa
ggaatttctatccgtcacccagcgcggtttgttctggttggttcaggaaacccagaagaa
ggagaactccgtccccaactactcgaccgcttcggaatgcacgccgaaattcacacagtg
aaagaaccagcattgcgggtgcacattgtggaaaaaaggtcagaatttgaccaaaatccc
ccgttttttctagaaaattacaaatccgaacaagaaggattacaggaaaaaattgtcaag
gctcaagaattgttaccccaagttaaccttgactatgacctgcgggtgaaaatttcagaa
gtttgttcagaattagatgttgatggtttgcggggtgacattgtaaccaaccgcgctgct
aaagccttaaccgcctttgaaggaaggacacaagttaccgttgatgatatccgacgggta
attactttatgtctgcgtcaccgtttacggaaggatcctttagaatcaattgattctggc
tacaaagtgcaaaaagcttttgctcgcgtttttggtgtggaactttcagaagatgatgct
gcacagaaaaacgggacaggaatcaaaggtggggcgcgttag

DBGET integrated database retrieval system