KEGG   'Nostoc azollae' 0708: Aazo_3680Help
Entry
Aazo_3680         CDS       T01260                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
naz  'Nostoc azollae' 0708
Pathway
naz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:naz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aazo_3680
DNA repair and recombination proteins [BR:naz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Aazo_3680
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aazo_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_3
Motif
Other DBs
NCBI-ProteinID: ADI65239
UniProt: D7E421
Position
3741333..3741902
Genome map
AA seq 189 aa AA seqDB search
MIEQLQRLPGVGPKSAQRLALHILKRPEAEVEALAQALIDAKKQVGLCQVCYHLSSEPVC
DICRNPNRDNTTICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPEQLTAQALVR
RVSQQQPQEVIMAISPSVEGETTTLYIGELLKPFTKVTRIAFGLPVGGDLEYADEVTLVR
ALEGRRELD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgattgaacaactgcaacgcctccccggagtgggacccaaatccgcccagcgtctagcg
ttgcatattttaaagcgcccagaggcagaagttgaagctttggcacaggcactaattgat
gcgaaaaaacaggtagggttgtgtcaagtttgctatcacctctcatctgaacctgtatgt
gatatctgccgcaatcctaaccgggataatacaactatctgtgtggttgcagattcccgt
gatgtgattgcattggaaaaaacccgcgagtataaaggtaaatatcatgtcttaggtggg
gtgatttctcccatggatggtattggacctgaacagttgacggctcaagctttggtgcgg
agagtcagtcaacaacagccacaagaagtaattatggctattagtcctagtgtagaaggg
gaaaccactactttatatataggtgagttactcaaaccttttacgaaagttacgcggatt
gcttttggtttacctgtgggtggtgatttagagtatgctgatgaggtgacactggttaga
gctttggaaggacgacgggaattagattaa

DBGET integrated database retrieval system