KEGG   'Nostoc azollae' 0708: Aazo_4602Help
Entry
Aazo_4602         CDS       T01260                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00030  Pentose phosphate pathway
naz00051  Fructose and mannose metabolism
naz00680  Methane metabolism
naz00710  Carbon fixation in photosynthetic organisms
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
naz01230  Biosynthesis of amino acids
Module
naz_M00165  Reductive pentose phosphate cycle (Calvin cycle)
naz_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
naz_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_4602
   00030 Pentose phosphate pathway
    Aazo_4602
   00051 Fructose and mannose metabolism
    Aazo_4602
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_4602
   00680 Methane metabolism
    Aazo_4602
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Aazo_4602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ADI65846
UniProt: D7DXM0
Position
complement(4703208..4704281)
Genome map
AA seq 357 aa AA seqDB search
MALVPMRLLLDHAAENGYGIPAFNVNNLEQIQAIMNAAAETDSPVILQASRGARNYAGEN
FLRHLILAAVETYPQIPIVMHQDHGNAPSTCYSAIKNNFTSVMMDGSLEADAKTPASFEY
NVKVTSEVVNVAHSLGVSVEGELGCLGSLETGAGEAEDGHGFEGTLDHSQLLTDPDEAVN
FVEATQVDALAVAIGTSHGAYKFTRKPTGEILAISRIEEIHRRLPNTHLVMHGSSSVPED
LIALINEFGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAVREALAANPKEFD
PRHFLKPSIKYMQKVCADRYEQFGTAGNASKIKQISLEDFAAKYAKGELVMRAAAKV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgtaccaatgcggctacttttggatcacgctgctgaaaatggttatggcata
cccgcttttaacgtaaacaacttagagcagattcaagccattatgaacgcagcggctgaa
acagacagccctgtaattttacaagcttctcgcggcgcacgtaattatgcaggagaaaac
ttcctgcgccacctgattttggcagcagtagaaacctatcctcagatccccattgtcatg
caccaggatcatggtaatgctccttctacctgctattcagcaatcaaaaacaacttcacc
agcgtgatgatggatggttctttagaagctgacgctaagactcctgcaagctttgagtat
aacgttaaagttaccagcgaagttgtcaacgtagctcactctttgggtgtcagcgttgaa
ggtgaattaggctgtttaggttctctagaaaccggcgctggtgaagctgaagatggtcat
ggttttgaaggtactcttgaccactctcaacttttaactgaccctgatgaagctgttaac
ttcgtggaagcaactcaagtagacgctttagctgttgctatcggtactagccacggtgct
tacaagtttacccgtaagcctactggtgaaatcttggctatcagccgcattgaagaaatt
caccgccgcttacctaatacccacttggtaatgcacggttcttcttctgtacctgaagat
ttgattgcgctaattaacgaatttggtggtgctattcctgaaacttacggtgtacctgta
gaagaaattcaaaaaggtatcaagagtggtgtacgtaaggtaaatattgacactgataac
cgtttagctattactgcggctgtccgtgaagcattagcagctaatcccaaggaatttgac
ccccgtcacttcctcaagccttccattaaatatatgcagaaggtttgtgctgatcgctat
gagcagtttggtactgctggtaatgcaagcaagattaagcagatttctttagaagatttt
gctgctaagtatgctaaaggcgaattggtaatgagagcggctgctaaagtttaa

DBGET integrated database retrieval system