KEGG   'Nostoc azollae' 0708: Aazo_4942Help
Entry
Aazo_4942         CDS       T01260                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00260  Glycine, serine and threonine metabolism
naz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01130  Biosynthesis of antibiotics
naz01230  Biosynthesis of amino acids
Module
naz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aazo_4942
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aazo_4942
Enzymes [BR:naz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aazo_4942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG ALF
Motif
Other DBs
NCBI-ProteinID: ADI66075
UniProt: D7DZ54
Position
5056102..5056908
Genome map
AA seq 268 aa AA seqDB search
MTTTISRCFETLRRNHECALIPFITAGDPDLETTGKALQVLDRSGADIIELGVPYSDPLA
DGPVIQAAATRALERGTTLDQVLAMLHATTPGLQAPIVLFTYYNPILHRGIEKFLEQIKA
AGVAGLVVPDLPLEEAAGLLEPASEVGIDLTLLVAPTSSAQRIKAIARASQGFIYLVSVT
GVTGMRNQMESRVSDLLTQIRSVTDKPIGVGFGIWETEQARQVREWGADAAIVGSAIVKR
LAEGTPEAGLDAIAEFCHNLKSGIKTTS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactactacaatttctcgttgttttgaaactctcagacggaatcacgagtgcgctctg
attccgtttattactgctggtgatcctgatttagaaactactggtaaggctttgcaagtt
ctagatcgttctggtgcggatattattgagttgggtgttccctattctgatcctttggca
gatggtcctgtgattcaagcggctgctacccgtgctttggagaggggtactactttggat
caggtgttggcaatgctgcacgcaactactcctggtttacaagcgccaattgttttattt
acttactacaacccgatattgcatcgaggaattgagaagtttctggaacaaattaaggct
gctggtgtagcgggtttggttgttcctgatttacctctggaagaggcggcagggttgtta
gaaccagcttctgaggtggggattgatttaactctcttagtcgctcctacaagttctgcc
cagaggataaaagcgatcgctcgtgcttcccaaggatttatctatttggtgagtgtaact
ggtgtgacgggaatgcgaaaccaaatggaaagccgagtttctgatttactcacacaaatt
cgctctgtcacagataaacctattggtgtgggctttggtatttgggaaacggaacaagca
cgtcaagtccgagaatggggtgcagatgcagcgattgtcgggagtgctattgtcaagcgg
ttggcagaaggaacaccggaagcaggacttgatgcgatcgcagaattctgccacaatctg
aagtcaggtatcaaaactacctcttga

DBGET integrated database retrieval system