KEGG   Neisseriaceae bacterium DSM 100970: CUN60_01765Help
Entry
CUN60_01765       CDS       T05482                                 

Definition
(GenBank) hypothetical protein
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
nba  Neisseriaceae bacterium DSM 100970
Pathway
nba00780  Biotin metabolism
nba01100  Metabolic pathways
Module
nba_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CUN60_01765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nba01007]
    CUN60_01765
Enzymes [BR:nba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CUN60_01765
Amino acid related enzymes [BR:nba01007]
 Aminotransferase (transaminase)
  Class II
   CUN60_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUR51084
UniProt: A0A2I7N3P0
Position
375168..376361
Genome map
AA seq 397 aa AA seqDB search
MLAPAWNRQIDEAINKLPLIRNRYPRSGSSSSKVIVREGQSYHNFISNDYLGLSTHPELK
QAFKIACDDYGIGSTGAASLSGYTEAQYILEQNLAQWLQLEDVLVMNSGFSLNSSLYKSL
SNANTMIWLDKNCHASHIDGVLASKSRFARFDGNNITDLRSKISRLPDLLHLVISEGVFS
MDGSSDYLAGLIQLRKDFQDQLLLVVDDAHGVGVIGKNGFGQIEKIGFLPKDIDLYIGTL
GKTFASHGGFIGGNKWIIEYLRQSIRAQIYTTCLPPAIHAASNAALTIIKSGEGFKLRQQ
LLANIDFFKAQVKNLNIQLMYRDINYSPIQLIDGYSLAQLSYLAKYLQDKKILAGFIRYP
TVAKNSPRIRLSLLATHTYDDISNLCYEIQQGLSYVS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaccagcgtggaatagacagatagacgaggcaatcaataaattgccattgatt
cgtaaccgttatccacgtagcggttcaagctctagtaaagttatagttcgcgaagggcaa
agctatcataattttattagcaatgattatcttggtttaagtacgcatccagaattaaag
caagcattcaaaatagcttgtgatgattatggtattgggagtactggtgccgctagcctt
agtggttatactgaagctcaatatattctagaacagaatctcgcgcaatggctgcaattg
gaagatgttttagttatgaatagtggctttagcctgaatagttcattatataagtcattg
tctaatgctaatacgatgatctggcttgataaaaattgtcatgcttcccatattgatggt
gtacttgctagtaaatcacgttttgcacgctttgatggcaataatattactgatttacgg
agtaaaatttctaggttgccggatttacttcatttggtgattagtgagggtgtctttagt
atggatggtagctcagactatttggcgggattgattcaacttcggaaagactttcaagat
cagctgcttttagtggtcgatgatgcacatggggttggtgttattggtaaaaatggtttt
gggcagattgagaaaataggttttttaccaaaagatattgatttatacattgggacatta
ggtaaaacttttgcttcacatgggggatttattggtggaaataaatggattattgagtat
ctccggcaaagtattcgtgcccagatttatactacttgcttgcctccggctattcatgct
gcaagtaatgcagcacttactatcataaagagtggagaagggtttaaattacgccagcaa
ttattggcaaatattgattttttcaaagcccaagtaaaaaatctgaatatccaattaatg
tatcgtgacataaattattcgccaatccaattgatcgatggctattcacttgcgcaatta
tcttatctggcaaagtatttgcaggataaaaagattcttgctggatttatccgttatccg
acagtagcaaaaaatagtccacgtatccgactatctttacttgctactcatacttacgat
gatatatctaacttatgttatgaaatacagcaaggcttgtcatatgtcagctaa

DBGET integrated database retrieval system