KEGG   Natronorubrum bangense: DV706_00705Help
Entry
DV706_00705       CDS       T05942                                 

Definition
(GenBank) PksG family protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00072  Synthesis and degradation of ketone bodies
nbg00280  Valine, leucine and isoleucine degradation
nbg00650  Butanoate metabolism
nbg00900  Terpenoid backbone biosynthesis
nbg01100  Metabolic pathways
nbg01110  Biosynthesis of secondary metabolites
nbg01130  Biosynthesis of antibiotics
Module
nbg_M00849  C5 isoprenoid biosynthesis, mevalonate pathway, archaea
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DV706_00705
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    DV706_00705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DV706_00705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DV706_00705
Enzymes [BR:nbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     DV706_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C
Motif
Other DBs
NCBI-ProteinID: QCC53127
UniProt: A0A4D6HK40
Position
141884..143221
Genome map
AA seq 445 aa AA seqDB search
MTAVGIDAIEIWTGNLKLDLPGTFAPEKGEDPEKYTKGLGLNASSFPDSYEDIVTMGANA
AHRLMERKGLEPDDIGRIDVATESAFDNSKPVSTYVAGCLEQVYDGDFHHANKGERKFAC
IAGTQSLDDAYNWIRAGRNRGRGALVIATDTALYARGDAGEATQGAGAVAMYISEDPDLV
ELSTDQGYGSADETDFLKPNQQFPSVDGKRSVQVYLARMREALEDYESVAGDVHPDDFAF
APFHTPFPGMVRKAAMLAYRHVTRDTAIEEELAKEIGRQPRAEAFDDKESFHDAVREYMD
ALKETDRYQEWYAETIDPTLTLSREVGNWYTGSVHIARVSAMKYALQNGQDLAGETMLVG
SYGSGAQAEIHAETVQDTWEKEIEALNVDAQLEARYDLSWEDYEEIHDVHNHDMDVDVEE
FTTPEAEFVFDGWGRMGERKYRYVE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtcggtatcgacgccatcgagatctggaccgggaatctcaaactcgacttg
ccgggaacgttcgcgcccgagaagggcgaggaccccgaaaagtacacgaaagggctcggt
ctcaacgcgagttcgttccccgacagctacgaagacatcgtcacgatgggcgcaaacgct
gcccaccgactgatggagcgcaagggtctcgagcccgacgatatcggccgtatcgacgtc
gcgaccgagagcgccttcgacaactcgaagccggtttcgacgtacgtcgctggctgctta
gagcaggtgtacgacggcgacttccaccacgcgaacaaaggcgaacggaagttcgcctgt
atcgcgggcacacagagtctcgacgacgcctacaactggatccgtgcgggccgaaatcgt
ggccgcggcgcgctcgtgatcgcaaccgacacggcgctgtacgcccgcggtgacgccggc
gaggcgacccagggtgccggtgccgtcgcgatgtacatctccgaagatcctgatctcgtc
gaactctcgaccgatcaggggtatgggtcggctgacgagactgacttcctcaaaccaaac
cagcagttcccttccgtcgacggcaaacgctcggtacaggtgtatctcgctcgcatgcgc
gaagcgctcgaggactacgagagcgtcgccggcgacgtccaccccgacgacttcgcgttc
gcgccgttccacaccccgttcccgggaatggtccgaaaggcggcgatgctcgcgtaccga
cacgtcacgcgtgacaccgcgatcgaggaggaactcgccaaggaaatcggccgccagccc
cgtgccgaggcgttcgacgacaaagagtcgttccacgacgccgtccgcgagtacatggac
gcgctcaaagaaaccgatcggtatcaggagtggtacgccgagaccatcgacccaacgctg
acgctctctcgcgaggtcggcaactggtacaccggctccgtccacatcgcccgtgtgagc
gcgatgaagtacgccctccagaacggccaggatcttgctggcgagacgatgctcgtcggc
tcctacggtagcggtgcccaggccgagatccacgccgaaaccgtccaagacacctgggaa
aaagagatcgaggcgttgaacgtcgacgcccagctcgaagcgcgctatgacctctcttgg
gaggactacgaggagatccacgacgtccacaaccacgacatggacgtcgacgtcgaggag
ttcacgacgcccgaagcggagttcgtcttcgacggttggggccgaatgggcgaacggaag
taccggtacgtcgaataa

DBGET integrated database retrieval system