KEGG   Natronorubrum bangense: DV706_06380Help
Entry
DV706_06380       CDS       T05942                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nbg  Natronorubrum bangense
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DV706_06380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QCC54146
UniProt: A0A4D6HLN6
Position
complement(1271588..1272781)
Genome map
AA seq 397 aa AA seqDB search
MVELVTIGTFLVAAVASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGFLVGILGFAGA
VLQGANVSEAVGADLIGGVTLSPMAATIALIIAAGLVAIGVFAGYPIATAFTVTGAVIGV
GLAMGGDPAWAKYQEIATLWILTPFVGGGLAYGIARLLRSKPIAEEYLIMMLAALIGIVV
ANIEFAILGSGAGGGASIAEASSGWLPGPDIAGVAAVTVVIAALWAGVTGFDLRGDIERG
ERHFLLVLGGLVAFSAGGSQVGLAVGPLIPLSGDVGLPLLALLVGGGFGLLLGSWTGAPR
MIKAISQDYSSLGPRRSIAALIPSFMIAQTAVLYGIPVSFNEIIVSAIIGSGYAAAGAGG
GVSARKMGYTVLAWVASLVGSVVISYVGYIVIFAVLG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagctcgtgacgatcgggacgtttctggtggctgcagtggccagtctgttcatg
gcctgggcgatcggtgctggctcgagcgggtcgactccgtttgcaccggccgttggtgcg
aacgcgatatcggtgatgcgggctggatttctcgttggtattctcggctttgctggggcc
gttttgcagggtgcaaacgtctccgaggccgtcggtgccgacctgatcggcggcgtgacg
ctgtcgccgatggcggcgacgatcgccctgattatcgcagccggactggtcgcgatcggc
gtcttcgcggggtatccgatcgcgactgcctttaccgttaccggagcggtgatcggcgtt
gggctcgcgatgggcggcgatccagcatgggcgaaatatcaggagatcgccaccctctgg
attctgacgccgttcgtcggcggcggactcgcctacgggatcgcccgcctgctgcggagt
aaaccgatcgccgaagagtatctcatcatgatgctcgcagcgctgatcggcatcgtcgtc
gccaacatcgagttcgcgatcctcggctccggagctggcggcggggcgtcgatcgccgag
gcctcgagtggctggcttcccggccccgatatcgctggtgtcgccgcagtgacggtcgtc
atcgcggcgctctgggcgggggtgactgggttcgacttgcgaggcgatatcgaacgcggt
gaacgccacttcctgctcgtcctcggcggactggtcgcgttctccgcgggtgggagtcag
gtcggactggcagttggcccgctgatcccgctgtcgggtgacgttggcctgccactcctt
gccctgctcgttggtggcggcttcgggctcttgctggggtcgtggaccggcgcgccgcgg
atgatcaaggcgatctcacaggactactcctcgcttggaccacgccggtcgatcgccgca
cttattccctcgtttatgatcgcacagacggcagtgctgtacggcattccggtttcgttt
aacgaaattatcgtcagtgcgatcatcggcagcgggtacgctgcagccggcgctggtggt
ggtgtcagcgcccgtaagatggggtatactgtcctcgcatgggtcgcatcgctcgtcggc
tcggttgtcatttcctacgtcggctacatcgtgattttcgccgtcctgggatag

DBGET integrated database retrieval system